CN186080

Overview
NameCN186080
Unique NameCN186080
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length708
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig378 contig Csv1_Contig378:145..851. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_ARATH (Anthranilate phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.665e-70
Identity = 136/177 (76.84%), Postives = 153/177 (86.44%), Query Frame = 2
Query:  176 FNELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            FN+LI+ LI RVDL+E EA++SL++LLNEA+EALISAFLVLLRAKGET+ EIVGLARAM+K+A KVEGL DAVDIVGTGGDGANTVNISTG+SILAAACGAKVAKQ            DVLEALGVV+DL PEG++RCV+E GIGFMMS  YHPAMK V PVRKKLK+KTVFNILGP
Sbjct:  108 FNQLIETLIDRVDLSETEAESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLARAMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGSADVLEALGVVLDLGPEGIKRCVEEGGIGFMMSPMYHPAMKIVGPVRKKLKIKTVFNILGP 284          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_ACIC1 (Anthranilate phosphoribosyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=trpD PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.162e-40
Identity = 87/181 (48.07%), Postives = 123/181 (67.96%), Query Frame = 2
Query:  167 TPCFNELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            TP + E++  L++R DLTEAEA  ++  +++ EA +A I+AF V LRAKGE+  E+ GL+  M+  AA V  +G+A+DIVG+GGD A+TVNIST A+I+AAA G  VAK             D+LEALGV IDLD  GV RC++ AGIGF  +  +HP++++    R+++ + TVFN LGP
Sbjct:    5 TPSWPEVLSALLARRDLTEAEAAWAMHQIMSGEATDAQIAAFAVALRAKGESAEEVSGLSSVMLALAAPVPPIGEALDIVGSGGDRAHTVNISTMAAIVAAATGVVVAKHGNRAASSACGSADLLEALGVAIDLDGAGVARCIERAGIGFCFAPVFHPSLRYAAVARREIGIPTVFNFLGP 185          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_CHLAD (Anthranilate phosphoribosyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=trpD PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.734e-39
Identity = 87/176 (49.43%), Postives = 114/176 (64.77%), Query Frame = 2
Query:  182 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            E I  +++R DLT+AEA + ++ ++N  A  A I+AFL  L  KGET  EI G+A  M + A  V   G  +D  GTGGDGA+T NIST A+ +AA  G  VAK             DVLE LGV I+LD EGV RC+ +AGIGFM + K+HPAM+F  PVR+++ ++TVFNILGP
Sbjct:    5 EAIAAVVARRDLTQAEAASVMEEIMNGTATPAQIAAFLTALHIKGETDAEIAGMAAVMREKATHVYFDGPVIDTCGTGGDGAHTFNISTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGLGVQIELDAEGVARCLRDAGIGFMFAPKFHPAMRFAGPVRREIGIRTVFNILGP 180          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_CHLSY (Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=trpD PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.169e-38
Identity = 87/176 (49.43%), Postives = 113/176 (64.20%), Query Frame = 2
Query:  182 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            E I  +++R DLT+AEA + ++ +++  A  A I AFL  L  KGET  EI G+A  M + A  V   G  +D  GTGGDGA+T NIST A+ +AA  G  VAK             DVLE LGV I+LD EGV RC+ EAGIGFM + K+HPAM+F  PVR+++ ++TVFNILGP
Sbjct:    5 EAIAAVVARRDLTQAEAASVMEEIMSGTATPAQIGAFLTALHMKGETDAEIAGMAAVMREKATHVYFDGPVIDTCGTGGDGAHTFNISTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGLGVQIELDAEGVARCLREAGIGFMFAPKFHPAMRFAGPVRREIGIRTVFNILGP 180          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_CHLAA (Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trpD PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.169e-38
Identity = 87/176 (49.43%), Postives = 113/176 (64.20%), Query Frame = 2
Query:  182 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            E I  +++R DLT+AEA + ++ +++  A  A I AFL  L  KGET  EI G+A  M + A  V   G  +D  GTGGDGA+T NIST A+ +AA  G  VAK             DVLE LGV I+LD EGV RC+ EAGIGFM + K+HPAM+F  PVR+++ ++TVFNILGP
Sbjct:    5 EAIAAVVARRDLTQAEAASVMEEIMSGTATPAQIGAFLTALHMKGETDAEIAGMAAVMREKATHVYFDGPVIDTCGTGGDGAHTFNISTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGLGVQIELDAEGVARCLREAGIGFMFAPKFHPAMRFAGPVRREIGIRTVFNILGP 180          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_CHLFF (Anthranilate phosphoribosyltransferase OS=Chlamydophila felis (strain Fe/C-56) GN=trpD PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.554e-36
Identity = 79/173 (45.66%), Postives = 114/173 (65.90%), Query Frame = 2
Query:  188 IDCLISRVDLTEAEAQASLDYLLNEADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            +  ++++  LT  EA++  + +LN +D   I+AFL +L+ +GET  EI G+  A+ K A  V+    A+DIVGTGGD ANTVNISTG++IL+AACG  +AK             DVLEALG+ I++ PE +  C+ E GIGFM +  YHP++K + P+RK +K+ + FNILGP
Sbjct:    6 LQSIMNQSHLTYDEAESVTNLMLNGSDPHQIAAFLAVLKYRGETPTEIAGMVSALQKQATSVDLPFPALDIVGTGGDLANTVNISTGSAILSAACGIPIAKHGNRSVSSQSGSADVLEALGIEIEMTPEELLSCIQEVGIGFMFAPIYHPSLKKLAPIRKGMKIPSTFNILGP 178          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_CHLCV (Anthranilate phosphoribosyltransferase OS=Chlamydophila caviae GN=trpD PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.030e-36
Identity = 81/173 (46.82%), Postives = 112/173 (64.74%), Query Frame = 2
Query:  188 IDCLISRVDLTEAEAQASLDYLLNEADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            +  ++++  LT  E ++  + +LN AD   I+AFL +L+ +GET  E+ G+  A+ K A  V     A+DIVGTGGD ANTVNISTG++ILAAACG  +AK             DVLEALG+ I++ PE +  CV E GIGFM +  YHP++K + P+RK +K  +VFNILGP
Sbjct:    6 LQSIMNQSHLTYDEVESVTNLMLNGADPHQIAAFLAVLKYRGETPTEVAGMISALQKQATPVNLPFPALDIVGTGGDLANTVNISTGSAILAAACGIPIAKHGNRSVSSQSGSADVLEALGIEIEMSPEELLSCVQEVGIGFMFAPIYHPSLKKLAPIRKGMKFPSVFNILGP 178          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_HERA2 (Anthranilate phosphoribosyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=trpD PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.906e-36
Identity = 81/176 (46.02%), Postives = 112/176 (63.64%), Query Frame = 2
Query:  182 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            + I  + +R DL++ +A A ++ ++N EA  A I+A L  L  KGET  EI G+A+ M   +  V   G  VD  GTGGD +NT NIST A+ +AA  GA VAK             DVLE LGV I+LD EGV RC+ +AGIGFM + K+HPAM++  PVR+++ ++T+FN+LGP
Sbjct:    5 DAIITVTNRTDLSQDDAAAVMEQMMNGEATPAQIAALLTALHFKGETDAEIAGMAQVMRAKSLAVPHDGGVVDTCGTGGDHSNTFNISTTAAFVAAGAGATVAKHGNRAMSSKCGSADVLEGLGVNIELDAEGVARCLRQAGIGFMFAPKFHPAMRYAGPVRREIGIRTIFNVLGP 180          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_ROSCS (Anthranilate phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpD PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.718e-35
Identity = 80/166 (48.19%), Postives = 104/166 (62.65%), Query Frame = 2
Query:  212 DLTEAEAQASLDYLLNE-ADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            DLTE +A  +++ ++   A  A ++A L  L  KGET  EI G+AR M   A  V   G  +D  GTGGD A T NIST A+ +AA  GA VAK             DVLE LGV IDLD  GV RC+++AGIGFM + K+HPAM+FV PVR+++ ++T+FN LGP
Sbjct:   15 DLTEEQAAEAMEEIMTGVATPAQVAALLTALHLKGETDAEIAGMARVMRAKAIPVHFDGPLLDTCGTGGDSAGTFNISTTAAFIAAGAGATVAKHGNRAMSSVCGSADVLEGLGVTIDLDAAGVARCLEQAGIGFMFAQKFHPAMRFVGPVRREIGIRTIFNALGP 180          
BLAST of CN186080 vs. ExPASy Swiss-Prot
Match: TRPD_METMA (Anthranilate phosphoribosyltransferase OS=Methanosarcina mazei GN=trpD PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.718e-35
Identity = 85/177 (48.02%), Postives = 110/177 (62.15%), Query Frame = 2
Query:  182 ELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFLVLLRAKGETFGEIVGLARAMIKYAAKVEGLGD--AVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGP 706
            E I  L    DL+  EA+A+L+ +L+ A++  I  FL+ L+AKGE   EIVG  R M K    ++       VD  GTGGDG NT+N+ST A+I+ AA G  VAK             DVLEALG+ +DL PE VR+ +++ GIGFM +  +HPAMK V  VRKKL V+TVFNILGP
Sbjct:    6 EYIKKLEEGCDLSSEEAEAALEEVLSTAEDGEIETFLLALKAKGEKPQEIVGFVRGMKKAGNMIKPNTPFRIVDTCGTGGDGLNTINVSTAAAIVTAAAGVPVAKHGNRAATSMTGSSDVLEALGIKVDLSPEYVRKTIEKIGIGFMFAPVFHPAMKRVAGVRKKLGVRTVFNILGP 182          
The following BLAST results are available for this feature:
BLAST of CN186080 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
TRPD_ARATH3.665e-7076.84Anthranilate phosphoribosyltransferase, chloroplas... [more]
TRPD_ACIC15.162e-4048.07Anthranilate phosphoribosyltransferase OS=Acidothe... [more]
TRPD_CHLAD9.734e-3949.43Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_CHLSY2.169e-3849.43Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_CHLAA2.169e-3849.43Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_CHLFF1.554e-3645.66Anthranilate phosphoribosyltransferase OS=Chlamydo... [more]
TRPD_CHLCV2.030e-3646.82Anthranilate phosphoribosyltransferase OS=Chlamydo... [more]
TRPD_HERA25.906e-3646.02Anthranilate phosphoribosyltransferase OS=Herpetos... [more]
TRPD_ROSCS1.718e-3548.19Anthranilate phosphoribosyltransferase OS=Roseifle... [more]
TRPD_METMA1.718e-3548.02Anthranilate phosphoribosyltransferase OS=Methanos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002F09_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002F09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186080 ID=CN186080|Name=CN186080|organism=Citrus sinensis|type=EST|length=708bp
AGGGTTTCTTCCTCTCCATTTAATAATAATCACCCAAACCACCGGCCTTT
CTTACCGTCGCTTGGGAACTGTGGATTTACGACTGCGGGTAATAATCCGA
GATGCAGAGAATTAACTGCTATTCAAACCCCTCAGCCGGCTGTTTCTGAT
AGATACTCGTCCTCAAACGCCCTGCTTTAATGAGTTGATCGATTGCTTGA
TAAGTCGAGTGGATTTAACGGAGGCGGAGGCTCAAGCTTCGCTGGATTAC
TTGTTGAATGAAGCTGATGAGGCCTTGATTAGTGCTTTTCTTGTTTTGCT
CAGAGCCAAAGGAGAAACATTTGGAGAGATTGTGGGATTGGCCAGGGCGA
TGATAAAGTATGCTGCGAAGGTGGAAGGGCTGGGTGATGCAGTTGACATT
GTGGGTACAGGAGGTGATGGTGCAAACACAGTGAACATTTCAACTGGTGC
TTCAATTCTTGCCGCAGCTTGTGGTGCAAAAGTTGCCAAGCAAGGGAGTC
GGTCTAGTTCTTCTGCATGTGGAAGTGCTGATGTGTTAGAAGCTTTGGGT
GTCGTTATTGACTTGGACCCAGAGGGTGTAAGAAGGTGTGTGGATGAGGC
AGGAATTGGTTTCATGATGTCGACAAAGTATCACCCTGCAATGAAGTTTG
TCAGGCCAGTGAGGAAAAAGCTCAAAGTAAAAACTGTATTCAATATATTG
GGTCCTAT
back to top