DC900139

Overview
NameDC900139
Unique NameDC900139
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length618
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900139_ssr206 microsatellite DC900139_ssr206:206..217. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1971 contig Csv1_Contig1971:103..662. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_ORYSJ (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica GN=CKS1 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.960e-32
Identity = 63/66 (95.45%), Postives = 64/66 (96.97%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 199
            YSEKYFDDTYEYRHVVLPP+VAKLLPKN LLSE EWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL
Sbjct:    6 YSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 71          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_ORYSI (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica GN=CKS1 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.960e-32
Identity = 63/66 (95.45%), Postives = 64/66 (96.97%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 199
            YSEKYFDDTYEYRHVVLPP+VAKLLPKN LLSE EWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL
Sbjct:    6 YSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 71          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_ARATH (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana GN=CKS1 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.505e-31
Identity = 61/66 (92.42%), Postives = 64/66 (96.97%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 199
            YSEKYFDDT+EYRHVVLPP+VAKLLPKN LLSE EWRAIGVQQSRGWVHYA+HRPEPHIMLFRRPL
Sbjct:    6 YSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRPEPHIMLFRRPL 71          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS2_ARATH (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana GN=CKS2 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.353e-31
Identity = 60/66 (90.91%), Postives = 65/66 (98.48%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 199
            YS+KYFDDT+EYRHVVLPP+VAKLLPKN +LSE+EWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL
Sbjct:    6 YSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 71          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_PHYPO (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.116e-26
Identity = 51/64 (79.69%), Postives = 59/64 (92.19%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR 193
            YSEKY+DD +EYRHV+LPPDVAK +PKN LLSE EWR +GVQQS+GWVHYA+HRPEPHI+LFRR
Sbjct:    8 YSEKYYDDKFEYRHVILPPDVAKEIPKNRLLSEGEWRGLGVQQSQGWVHYALHRPEPHILLFRR 71          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_MOUSE (Cyclin-dependent kinases regulatory subunit 1 OS=Mus musculus GN=Cks1b PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.969e-24
Identity = 47/66 (71.21%), Postives = 58/66 (87.88%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 199
            YS+KY D+ +EYRHV+LP D+AKL+PK  L+SE+EWR +GVQQS+GWVHY IH PEPHI+LFRRPL
Sbjct:    8 YSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL 73          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_HUMAN (Cyclin-dependent kinases regulatory subunit 1 OS=Homo sapiens GN=CKS1B PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.969e-24
Identity = 47/66 (71.21%), Postives = 58/66 (87.88%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 199
            YS+KY D+ +EYRHV+LP D+AKL+PK  L+SE+EWR +GVQQS+GWVHY IH PEPHI+LFRRPL
Sbjct:    8 YSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL 73          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_BOVIN (Cyclin-dependent kinases regulatory subunit 1 OS=Bos taurus GN=CKS1B PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.969e-24
Identity = 47/66 (71.21%), Postives = 58/66 (87.88%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPL 199
            YS+KY D+ +EYRHV+LP D+AKL+PK  L+SE+EWR +GVQQS+GWVHY IH PEPHI+LFRRPL
Sbjct:    8 YSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL 73          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_DROME (Cyclin-dependent kinases regulatory subunit OS=Drosophila melanogaster GN=Cks30A PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.184e-24
Identity = 44/65 (67.69%), Postives = 58/65 (89.23%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRP 196
            YS+KY+D+ +EYRHVVLP ++ K++PK  L++E EWR+IGVQQSRGW+HY IH+PEPHI+LFRRP
Sbjct:    7 YSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILLFRRP 71          
BLAST of DC900139 vs. ExPASy Swiss-Prot
Match: CKS1_PATVU (Cyclin-dependent kinases regulatory subunit OS=Patella vulgata PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 8.843e-24
Identity = 45/64 (70.31%), Postives = 56/64 (87.50%), Query Frame = 2
Query:    2 YSEKYFDDTYEYRHVVLPPDVAKLLPKNCLLSETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRR 193
            YS+KYFD+ +EYRHV+LP D+AK++PKN L+SE EWR+IGVQQS GW+HY  H PEPHI+LFRR
Sbjct:    8 YSDKYFDEDFEYRHVMLPKDIAKMVPKNHLMSEAEWRSIGVQQSHGWIHYMKHEPEPHILLFRR 71          
The following BLAST results are available for this feature:
BLAST of DC900139 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
CKS1_ORYSJ3.960e-3295.45Cyclin-dependent kinases regulatory subunit 1 OS=O... [more]
CKS1_ORYSI3.960e-3295.45Cyclin-dependent kinases regulatory subunit 1 OS=O... [more]
CKS1_ARATH1.505e-3192.42Cyclin-dependent kinases regulatory subunit 1 OS=A... [more]
CKS2_ARATH3.353e-3190.91Cyclin-dependent kinases regulatory subunit 2 OS=A... [more]
CKS1_PHYPO1.116e-2679.69Probable cyclin-dependent kinases regulatory subun... [more]
CKS1_MOUSE3.969e-2471.21Cyclin-dependent kinases regulatory subunit 1 OS=M... [more]
CKS1_HUMAN3.969e-2471.21Cyclin-dependent kinases regulatory subunit 1 OS=H... [more]
CKS1_BOVIN3.969e-2471.21Cyclin-dependent kinases regulatory subunit 1 OS=B... [more]
CKS1_DROME5.184e-2467.69Cyclin-dependent kinases regulatory subunit OS=Dro... [more]
CKS1_PATVU8.843e-2470.31Cyclin-dependent kinases regulatory subunit OS=Pat... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900139 VSS Citrus sinensis cDNA clone VS27V59 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900139 ID=DC900139|Name=DC900139|organism=Citrus sinensis|type=EST|length=618bp
GTACTCGGAGAAATACTTCGATGACACTTACGAGTACAGACACGTGGTTC
TTCCTCCTGATGTGGCAAAATTGCTTCCCAAGAATTGTCTCCTTTCTGAA
ACTGAATGGCGTGCAATTGGAGTTCAGCAGAGCCGTGGATGGGTTCACTA
TGCCATTCATCGTCCTGAACCACACATTATGCTCTTCCGCAGGCCTCTGA
ATTATCAGCAGCAGCAGGAGAATCAAGCTCAGCAAAACATACTTGCCAAG
TGATTTCACGTCGCTCTTTATGTCAAAGAATGGAAGGAATAGGAAGTTTA
GTGTTTTACCTAAAAGGTTTAAATGTCGTAGGATGTTTGGTACTGCATTG
TATCTCTATAAATGCAGAATTCCATGTTAGGCTTCGTTTGGTGAATGGAT
GTGTTGTTGACATCTTTGATGTCTTTGTTGCTGCCTGTTTAGATATGTGA
TGTTGATACTTCTTGTGTACTGCTTGTGGATGAAAAGGCACCGGTGAATT
CTGAGTGATTAAGCTTTTAGTTGTCTTCTCACTTGTGCTTTGTCTTTGGT
TAATTTAACAGTTGAGATCACAGGTTTAAATCCTCTGNGTTTGGTTTTGG
TATAAAGGGAAATTCAAT
back to top