DC900138

Overview
NameDC900138
Unique NameDC900138
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length451
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2445 contig Csv1_Contig2445:14..464. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900138 vs. ExPASy Swiss-Prot
Match: PLST4_ARATH (Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 1.288e-28
Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = -1
Query:  239 RIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAINVVETKGRSLEEIERAL 451
            RIRAKAVALSLGMHWISNFVIGLYFLSVV KFGIS+VYLGFA VC+LAVLYIA NVVETKGRSLEEIE AL
Sbjct:  472 RIRAKAVALSLGMHWISNFVIGLYFLSVVTKFGISSVYLGFAGVCVLAVLYIAGNVVETKGRSLEEIELAL 542          
BLAST of DC900138 vs. ExPASy Swiss-Prot
Match: PLST1_ARATH (Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 3.291e-16
Identity = 38/72 (52.78%), Postives = 51/72 (70.83%), Query Frame = -1
Query:  236 RIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAINVVETKGRSLEEIERALN 451
            R R K +  S  +HW+SNF++GL+FL +V K+G+ TVY  F +V LLA  +  +  VETKGRSLEEIE +LN
Sbjct:  447 RTRGKIMGFSFSVHWVSNFLVGLFFLDLVEKYGVGTVYASFGSVSLLAAAFSHLFTVETKGRSLEEIELSLN 518          
BLAST of DC900138 vs. ExPASy Swiss-Prot
Match: PLST2_ARATH (Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.106e-15
Identity = 35/71 (49.30%), Postives = 53/71 (74.65%), Query Frame = -1
Query:  239 RIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAINVVETKGRSLEEIERAL 451
            RIRAKA+A  + +HW+ NF +GL FL ++ K G   +Y  F+T CL+AV+++  NV+ETKG++L+EIE +L
Sbjct:  419 RIRAKAMAFCMSVHWVINFFVGLLFLRLLEKLGPRLLYSMFSTFCLMAVMFVKRNVIETKGKTLQEIEISL 489          
BLAST of DC900138 vs. ExPASy Swiss-Prot
Match: PLST3_ARATH (Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 8.389e-12
Identity = 32/71 (45.07%), Postives = 50/71 (70.42%), Query Frame = -1
Query:  239 RIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAINVVETKGRSLEEIERAL 451
            R+RA A+A+ L +HW+ NF +GL FL ++ + G   +   F   C++AV+++  NVVETKG+SL+EIE +L
Sbjct:  420 RLRATALAVCLAVHWVINFFVGLLFLRMLEQLGSVLLNAIFGFFCVVAVIFVQKNVVETKGKSLQEIEISL 490          
The following BLAST results are available for this feature:
BLAST of DC900138 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PLST4_ARATH1.288e-2891.55Plastidic glucose transporter 4 OS=Arabidopsis tha... [more]
PLST1_ARATH3.291e-1652.78Probable plastidic glucose transporter 1 OS=Arabid... [more]
PLST2_ARATH8.106e-1549.30Probable plastidic glucose transporter 2 OS=Arabid... [more]
PLST3_ARATH8.389e-1245.07Probable plastidic glucose transporter 3 OS=Arabid... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900138 VSS Citrus sinensis cDNA clone VS27V58 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900138 ID=DC900138|Name=DC900138|organism=Citrus sinensis|type=EST|length=451bp
GTTTTTTTCTTTTTTTTTTCAAAGAAACACATATATTTAACGAAAGTTGG
TTGGGTTTCAAATCTGTGCAAAACAGACCAAAATGAGAATCAGCAAACGA
GATAGTCCGGGAGATAGAATAAAGAAGGAAAGCTCTACAGAAGAAAATTG
TTTTGCTTATTCAAGGTCAGTGTCCACGAGCCGCAGGGAGATTATTACCC
ACCCACTTCTACCATTTTCAGTATCAAACTACTGGATTGAGAGCACGCTC
TATCTCCTCCAATGATCTTCCCTTTGTTTCTACAACATTAATGGCTATGT
ACAAGACGGCAAGGAGACAGACGGTTGCAAATCCCAAATACACTGTACTG
ATTCCAAACTTGTTTACAACGCTCAAGAAGTACAGTCCGATAACAAAGTT
TGAGATCCAATGCATGCCTAATGACAAAGCAACCGCTTTTGCTCTGATTC
T
back to top