DC900136

Overview
NameDC900136
Unique NameDC900136
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length305
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PAS2A_ORYSJ (Protein tyrosine phosphatase-like protein PASTICCINO 2A OS=Oryza sativa subsp. japonica GN=PAS2A PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 9.115e-25
Identity = 50/63 (79.37%), Postives = 56/63 (88.89%), Query Frame = 1
Query:   13 LIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSK 201
            LIY ALPY+K SE YCLRMPNKWNFSFD+FYA+IL L  YVPGSPHM+TYML QRKKAL+K+K
Sbjct:  157 LIYIALPYMKASEKYCLRMPNKWNFSFDFFYASILSLAIYVPGSPHMFTYMLAQRKKALAKAK 219          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PAS2B_ORYSJ (Protein tyrosine phosphatase-like protein PASTICCINO 2B OS=Oryza sativa subsp. japonica GN=PAS2B PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.245e-23
Identity = 48/63 (76.19%), Postives = 55/63 (87.30%), Query Frame = 1
Query:   13 LIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSK 201
            LIY ALPY+K +E YCLRMPNKWNFSFD+ YA+IL L  YVPGSPHM+TYML QRKKAL+K+K
Sbjct:  157 LIYIALPYMKATEKYCLRMPNKWNFSFDFSYASILSLAVYVPGSPHMFTYMLAQRKKALAKAK 219          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PAS2_ARATH (Protein tyrosine phosphatase-like protein PASTICCINO 2 OS=Arabidopsis thaliana GN=PAS2 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 8.531e-23
Identity = 50/65 (76.92%), Postives = 55/65 (84.62%), Query Frame = 1
Query:   13 LIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSKKE 207
            LIY ALP+IK SE Y +RMPN  NFSFD+FYA ILVL  YVPGSPHMY YMLGQRK+ALSKSK+E
Sbjct:  157 LIYLALPHIKTSEMYSVRMPNILNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE 221          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLA_MOUSE (Protein-tyrosine phosphatase-like member A OS=Mus musculus GN=Ptpla PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.776e-12
Identity = 29/62 (46.77%), Postives = 44/62 (70.97%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKAL 189
            +L  IY ALPY+K+S  + +R+PNK+N SFDY+Y  ++ +  Y+P  P +Y +ML QR+K L
Sbjct:  210 ELLTIYAALPYVKKSGMFSVRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVL 271          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLA_SHEEP (Protein-tyrosine phosphatase-like member A OS=Ovis aries GN=PTPLA PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.156e-11
Identity = 28/62 (45.16%), Postives = 44/62 (70.97%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKAL 189
            +L  IY ALPY+K++  + +R+PNK+N SFDY+Y  ++ +  Y+P  P +Y +ML QR+K L
Sbjct:  217 ELLTIYAALPYVKKTGMFSIRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVL 278          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLA_CANFA (Protein-tyrosine phosphatase-like member A OS=Canis familiaris GN=PTPLA PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.156e-11
Identity = 28/62 (45.16%), Postives = 44/62 (70.97%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKAL 189
            +L  IY ALPY+K++  + +R+PNK+N SFDY+Y  ++ +  Y+P  P +Y +ML QR+K L
Sbjct:  178 ELLTIYAALPYVKKTGMFSIRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVL 239          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLB_PONAB (Protein-tyrosine phosphatase-like member B OS=Pongo abelii GN=PTPLB PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.363e-11
Identity = 28/67 (41.79%), Postives = 48/67 (71.64%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSKK 204
            +L  IY ALP+++++  Y + +PNK+NFSFDY+   IL++  Y+P  P +Y +M+ QR+K LS +++
Sbjct:  184 ELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEE 250          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLB_HUMAN (Protein-tyrosine phosphatase-like member B OS=Homo sapiens GN=PTPLB PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.363e-11
Identity = 28/67 (41.79%), Postives = 48/67 (71.64%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSKK 204
            +L  IY ALP+++++  Y + +PNK+NFSFDY+   IL++  Y+P  P +Y +M+ QR+K LS +++
Sbjct:  183 ELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEE 249          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLB_BOVIN (Protein-tyrosine phosphatase-like member B OS=Bos taurus GN=PTPLB PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 3.363e-11
Identity = 28/67 (41.79%), Postives = 48/67 (71.64%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKALSKSKK 204
            +L  IY ALP+++++  Y + +PNK+NFSFDY+   IL++  Y+P  P +Y +M+ QR+K LS +++
Sbjct:  183 ELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQRRKILSHTEE 249          
BLAST of DC900136 vs. ExPASy Swiss-Prot
Match: PTPLA_HUMAN (Protein-tyrosine phosphatase-like member A OS=Homo sapiens GN=PTPLA PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.392e-11
Identity = 27/62 (43.55%), Postives = 44/62 (70.97%), Query Frame = 1
Query:    4 KLPLIYTALPYIKESETYCLRMPNKWNFSFDYFYAAILVLGFYVPGSPHMYTYMLGQRKKAL 189
            +L  IY ALP++K++  + +R+PNK+N SFDY+Y  ++ +  Y+P  P +Y +ML QR+K L
Sbjct:  217 ELLTIYAALPHVKKTGMFSIRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVL 278          
The following BLAST results are available for this feature:
BLAST of DC900136 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
PAS2A_ORYSJ9.115e-2579.37Protein tyrosine phosphatase-like protein PASTICCI... [more]
PAS2B_ORYSJ2.245e-2376.19Protein tyrosine phosphatase-like protein PASTICCI... [more]
PAS2_ARATH8.531e-2376.92Protein tyrosine phosphatase-like protein PASTICCI... [more]
PTPLA_MOUSE6.776e-1246.77Protein-tyrosine phosphatase-like member A OS=Mus ... [more]
PTPLA_SHEEP1.156e-1145.16Protein-tyrosine phosphatase-like member A OS=Ovis... [more]
PTPLA_CANFA1.156e-1145.16Protein-tyrosine phosphatase-like member A OS=Cani... [more]
PTPLB_PONAB3.363e-1141.79Protein-tyrosine phosphatase-like member B OS=Pong... [more]
PTPLB_HUMAN3.363e-1141.79Protein-tyrosine phosphatase-like member B OS=Homo... [more]
PTPLB_BOVIN3.363e-1141.79Protein-tyrosine phosphatase-like member B OS=Bos ... [more]
PTPLA_HUMAN4.392e-1143.55Protein-tyrosine phosphatase-like member A OS=Homo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900136 VSS Citrus sinensis cDNA clone VS27V55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900136 ID=DC900136|Name=DC900136|organism=Citrus sinensis|type=EST|length=305bp
GTGAAGTTGCCTCTTATTTACACTGCCCTTCCATACATAAAAGAATCCGA
GACGTATTGTCTTAGAATGCCAAACAAATGGAATTTCTCTTTTGACTACT
TCTACGCTGCAATTCTTGTGCTTGGATTCTATGTGCCAGGTAGTCCTCAT
ATGTATACATATATGCTTGGGCAGAGGAAGAAAGCCCTTTCGAAATCGAA
AAAAGAGTAAAATGGTTTTTTAACTGCAATGTCTATCAGTGTATCCTATC
AAAGATCTTGATAGAACTTTTGTTTGTTTATAATAATTAACCTAACCATT
TCCTC
back to top