DC900132

Overview
NameDC900132
Unique NameDC900132
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length370
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900132_ssr199 microsatellite DC900132_ssr199:199..210. BLAST: Citrus ESTs to Prunus persica proteins V1
DC900132_ssr287 microsatellite DC900132_ssr287:287..298. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1336 contig Csv1_Contig1336:1269..1638. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: SNAK2_SOLTU (Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.731e-20
Identity = 36/45 (80.00%), Postives = 41/45 (91.11%), Query Frame = 2
Query:    2 PNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136
            P LC+RACGTCCARCNCVPPGT+GNTE CPCYA++TTH  +RKCP
Sbjct:   60 PRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP 104          
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: GASA1_ARATH (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana GN=GASA1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.809e-18
Identity = 35/45 (77.78%), Postives = 38/45 (84.44%), Query Frame = 2
Query:    2 PNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136
            P LCHRACGTCC RCNCVPPGT GN + C CYA++TTH GRRKCP
Sbjct:   54 PRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP 98          
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.180e-16
Identity = 32/43 (74.42%), Postives = 38/43 (88.37%), Query Frame = 2
Query:    8 LCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136
            LC RAC +CC+RCNCVPPGT+GNT +CPCYA++TTH GR KCP
Sbjct:   57 LCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99          
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.013e-16
Identity = 33/45 (73.33%), Postives = 37/45 (82.22%), Query Frame = 2
Query:    2 PNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136
            PNLC RAC +CC RCNCVPPGTAGN  +CPCYA++TT  GR KCP
Sbjct:   55 PNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99          
The following BLAST results are available for this feature:
BLAST of DC900132 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SNAK2_SOLTU8.731e-2080.00Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1[more]
GASA1_ARATH2.809e-1877.78Gibberellin-regulated protein 1 OS=Arabidopsis tha... [more]
GASA2_ARATH1.180e-1674.42Gibberellin-regulated protein 2 OS=Arabidopsis tha... [more]
GASA3_ARATH2.013e-1673.33Gibberellin-regulated protein 3 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900132 VSS Citrus sinensis cDNA clone VS27V50 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900132 ID=DC900132|Name=DC900132|organism=Citrus sinensis|type=EST|length=370bp
GCCAAACCTGTGCCACAGGGCATGTGGTACCTGCTGCGCCCGCTGCAATT
GTGTTCCTCCAGGCACTGCAGGCAACACTGAGGTCTGCCCTTGCTACGCC
AATATGACCACCCACCACGGCAGACGCAAGTGCCCTTGAAATATTTTAAG
TTGAAACGACGTCGTCTACTTCTTAATTAATTTTTTTGGAGCTTCTATTC
TCTCTCTCTCTATGTATAAATATGTGCGTGTGCGTGTGCGTGTGTTGCCT
GTGGCCAGAAAAACAGAGTTGATCCATATTCCCATGAATAAATAAATAAA
TCCATTTCATGTTACTTATTGTGGATACATAAGTTTCCAGAGAATAATAA
TAAGAGGCTTCTTCTCCTTT
back to top