DC900132
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: SNAK2_SOLTU (Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1) HSP 1 Score: 95.5153 bits (236), Expect = 8.731e-20 Identity = 36/45 (80.00%), Postives = 41/45 (91.11%), Query Frame = 2 Query: 2 PNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136 P LC+RACGTCCARCNCVPPGT+GNTE CPCYA++TTH +RKCP Sbjct: 60 PRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP 104
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: GASA1_ARATH (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana GN=GASA1 PE=1 SV=2) HSP 1 Score: 90.5077 bits (223), Expect = 2.809e-18 Identity = 35/45 (77.78%), Postives = 38/45 (84.44%), Query Frame = 2 Query: 2 PNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136 P LCHRACGTCC RCNCVPPGT GN + C CYA++TTH GRRKCP Sbjct: 54 PRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP 98
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 1.180e-16 Identity = 32/43 (74.42%), Postives = 38/43 (88.37%), Query Frame = 2 Query: 8 LCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136 LC RAC +CC+RCNCVPPGT+GNT +CPCYA++TTH GR KCP Sbjct: 57 LCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99
BLAST of DC900132 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 2.013e-16 Identity = 33/45 (73.33%), Postives = 37/45 (82.22%), Query Frame = 2 Query: 2 PNLCHRACGTCCARCNCVPPGTAGNTEVCPCYANMTTHHGRRKCP 136 PNLC RAC +CC RCNCVPPGTAGN +CPCYA++TT GR KCP Sbjct: 55 PNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99 The following BLAST results are available for this feature:
BLAST of DC900132 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DC900132 ID=DC900132; Name=DC900132; organism=Citrus sinensis; type=EST; length=370bpback to top |