DC900131

Overview
NameDC900131
Unique NameDC900131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12640 contig Csv1_Contig12640:546..1640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: HSP7M_PHAVU (Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.146e-107
Identity = 203/223 (91.03%), Postives = 210/223 (94.17%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EELG*VQRK 669
            VDE LLVGGMTRVPKVQEVV  IFGKSPSKGVNPDEAVA+GAAIQGGILR DVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNK LGEF+LVGIPPAPRG+PQIEVTFDIDANGIVTVSAKDK+TGKEQQITIRSSGGLSEDEIEKMVKEAELHAQ+D ERK LIDIRN ADTTIYSI + LG  + K
Sbjct:  377 VDEVLLVGGMTRVPKVQEVVLNIFGKSPSKGVNPDEAVAMGAAIQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKMLGEFDLVGIPPAPRGLPQIEVTFDIDANGIVTVSAKDKSTGKEQQITIRSSGGLSEDEIEKMVKEAELHAQKDQERKTLIDIRNSADTTIYSIEKSLGEYREK 599          

HSP 2 Score: 113.62 bits (283), Expect = 2.071e-24
Identity = 61/88 (69.32%), Postives = 66/88 (75.00%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM-XXXXXXXXXXXXXXXXEQTPEAEYEEVKK 895
            + EKSLGEYREKIPSE AKEIEDAV+DLRKAM  DNVD+IKSKLDAANKAVSKIG+HM                 +Q PEAEYEEVKK
Sbjct:  588 SIEKSLGEYREKIPSETAKEIEDAVSDLRKAMSGDNVDEIKSKLDAANKAVSKIGEHMSGGSSGGSSAGGSQGGGDQAPEAEYEEVKK 675          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: HSP7M_PEA (Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 5.690e-107
Identity = 200/223 (89.69%), Postives = 213/223 (95.52%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EELG*VQRK 669
            VDE LLVGGMTRVPKVQ+VVSEIFGKSPSKGVNPDEAVA+GAA+QGGILR DVKELLLLDVTPLSLGIETLGGIFTRLI+RNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMA+DNKSLGEF+LVGIPPAPRG+PQIEVTFDIDANGIVTVSAKDK+TGKEQQITIRSSGGLS+DEI+KMVKEAELHAQRD ERKALIDIRN ADT+IYSI + L   + K
Sbjct:  378 VDEVLLVGGMTRVPKVQQVVSEIFGKSPSKGVNPDEAVAMGAALQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLISRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMAADNKSLGEFDLVGIPPAPRGLPQIEVTFDIDANGIVTVSAKDKSTGKEQQITIRSSGGLSDDEIDKMVKEAELHAQRDQERKALIDIRNSADTSIYSIEKSLAEYREK 600          

HSP 2 Score: 113.62 bits (283), Expect = 2.071e-24
Identity = 59/87 (67.82%), Postives = 64/87 (73.56%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHMXXXXXXXXXXXXXXXXEQTPEAEYEEVKK 895
            + EKSL EYREKIP+EVAKEIEDAV+DLR AM  +N DDIK+KLDAANKAVSKIGQHM                EQ PEAEYEEVKK
Sbjct:  589 SIEKSLAEYREKIPAEVAKEIEDAVSDLRTAMAGENADDIKAKLDAANKAVSKIGQHMSGGSSGGPSEGGSQGGEQAPEAEYEEVKK 675          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: HSP7M_SOLTU (Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.898e-94
Identity = 184/224 (82.14%), Postives = 198/224 (88.39%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRG-MPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYSI*EELG*VQRK 669
            VDE LLVGGMTRVPKVQE+VSEIFGKSPSKGVNPDEAVA+GAA+QGGILR DVKELLLLDVTPL+ GIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNK LGEF+LVGIPPAP+G  PQIEV FDIDANG+VTVSAKDKAT KEQQITIRSSGGLSEDEI+KMV+EAE+HAQR    + L+       TTIYSI + L   + K
Sbjct:  383 VDEVLLVGGMTRVPKVQEIVSEIFGKSPSKGVNPDEAVAMGAALQGGILRGDVKELLLLDVTPLARGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKLLGEFDLVGIPPAPKGYCPQIEVIFDIDANGMVTVSAKDKATSKEQQITIRSSGGLSEDEIDKMVREAEMHAQRIKNARHLLISGIVQSTTIYSIEKSLSEYKEK 606          

HSP 2 Score: 100.908 bits (250), Expect = 1.389e-20
Identity = 52/88 (59.09%), Postives = 62/88 (70.45%), Query Frame = 2
Query:  635 AFEKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM-XXXXXXXXXXXXXXXXEQTPEAEYEEVKK 895
            + EKSL EY+EK+P EV  EIE A++DLR AMG +N+DDIK+KLDAANKAVSKIG+HM                 +Q PEAEYEEVKK
Sbjct:  595 SIEKSLSEYKEKVPKEVVTEIETAISDLRAAMGTENIDDIKAKLDAANKAVSKIGEHMAGGSSGGASGGGGAQGGDQPPEAEYEEVKK 682          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_OLICO (Chaperone protein dnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.658e-93
Identity = 157/212 (74.06%), Postives = 184/212 (86.79%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PK+QEVV + FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK+LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLSE EIEKMVKEAE +A  D +R+  +D +N AD  ++S
Sbjct:  329 ISEVVLVGGMTRMPKIQEVVKQFFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIERNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKALGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSESEIEKMVKEAEANAAEDKKRREAVDAKNHADALVHS 540          

HSP 2 Score: 43.8986 bits (102), Expect = 1.658e-93
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     K IEDA+ADL++A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGSKVGEGERKAIEDALADLKEALKGDDSEAIKAKSNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_NITWN (Chaperone protein dnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.658e-93
Identity = 157/212 (74.06%), Postives = 187/212 (88.21%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLSE +IEKMVK+AE +A  D +R+  +D +NQAD+ ++S
Sbjct:  329 IGEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIEKMVKDAEANAAEDKKRREAVDAKNQADSLVHS 540          

HSP 2 Score: 44.669 bits (104), Expect = 1.658e-93
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  KI     + IEDAV+DL++A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALTEHGSKIEESERRAIEDAVSDLKEALKGDDAEAIKAKTNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BRUO2 (Chaperone protein dnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 4.803e-93
Identity = 153/212 (72.17%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ+ V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IEKMVK+AE +A+ D +R+  ++ +NQA++ ++S
Sbjct:  329 IDEVVLVGGMTRMPKIQEVVKAFFGKEPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRESVEAKNQAESLVHS 540          

HSP 2 Score: 48.9062 bits (115), Expect = 4.803e-93
Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+ ++  K IEDA+A L+ ++  ++ +DIK+K  A  +   K+GQ M
Sbjct:  542 EKSLAEYGDKVSADDKKAIEDAIAALKTSLEGEDAEDIKAKTQALAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BRUME (Chaperone protein dnaK OS=Brucella melitensis GN=dnaK PE=2 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 4.803e-93
Identity = 153/212 (72.17%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ+ V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IEKMVK+AE +A+ D +R+  ++ +NQA++ ++S
Sbjct:  329 IDEVVLVGGMTRMPKIQEVVKAFFGKEPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRESVEAKNQAESLVHS 540          

HSP 2 Score: 48.9062 bits (115), Expect = 4.803e-93
Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+ ++  K IEDA+A L+ ++  ++ +DIK+K  A  +   K+GQ M
Sbjct:  542 EKSLAEYGDKVSADDKKAIEDAIAALKTSLEGEDAEDIKAKTQALAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_BRUAB (Chaperone protein dnaK OS=Brucella abortus GN=dnaK PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 4.803e-93
Identity = 153/212 (72.17%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            +DE +LVGGMTR+PK+QEVV   FGK P KGVNPDE VA+GAAIQGG+L+ DVK++LLLDVTPLSLGIETLGG+FTRLI RNTTIPTKKSQ FSTA DNQ+ V I+V QGEREMA+DNK LG+F+LVGIPPAPRG+PQIEVTFDIDANGIV VSAKDK TGKE QI I++SGGLS+ +IEKMVK+AE +A+ D +R+  ++ +NQA++ ++S
Sbjct:  329 IDEVVLVGGMTRMPKIQEVVKAFFGKEPHKGVNPDEVVAMGAAIQGGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRRESVEAKNQAESLVHS 540          

HSP 2 Score: 48.9062 bits (115), Expect = 4.803e-93
Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EKSL EY +K+ ++  K IEDA+A L+ ++  ++ +DIK+K  A  +   K+GQ M
Sbjct:  542 EKSLAEYGDKVSADDKKAIEDAIAALKTSLEGEDAEDIKAKTQALAEVSMKLGQAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOPT (Chaperone protein dnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 4.803e-93
Identity = 155/212 (73.11%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLS+ EI+KMVK+AE +A  D +R+  +D +N AD  ++S
Sbjct:  329 ISEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSEIDKMVKDAEANAAEDKKRREAVDAKNHADALVHS 540          

HSP 2 Score: 45.0542 bits (105), Expect = 4.803e-93
Identity = 21/56 (37.50%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     + IEDA++DLR+A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGSKVDESERRSIEDALSDLREALKGDDAEAIKAKSNTLAQASMKLGEAM 597          
BLAST of DC900131 vs. ExPASy Swiss-Prot
Match: DNAK_RHOPA (Chaperone protein dnaK OS=Rhodopseudomonas palustris GN=dnaK PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 4.803e-93
Identity = 155/212 (73.11%), Postives = 185/212 (87.26%), Query Frame = 1
Query:    1 VDEXLLVGGMTRVPKVQEVVSEIFGKSPSKGVNPDEAVALGAAIQGGILRXDVKELLLLDVTPLSLGIETLGGIFTRLINRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMASDNKSLGEFELVGIPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEDEIEKMVKEAELHAQRDNERKALIDIRNQADTTIYS 636
            + E +LVGGMTR+PKVQEVV ++FGK P KGVNPDE VA+GAAIQ G+L+ DVK++LLLDVTPLSLGIETLGG+FTR+I+RNTTIPTKKSQVFSTA DNQ  V I+V QGEREMA+DNK LG+F+L+GIPPAPRGMPQIEVTFDIDANGIV VSAKDKATGKEQQI I++SGGLS+ EI+KMVK+AE +A  D +R+  +D +N AD  ++S
Sbjct:  329 ISEVVLVGGMTRMPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETLGGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIPPAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSEIDKMVKDAEANAAEDKKRREAVDAKNHADALVHS 540          

HSP 2 Score: 45.0542 bits (105), Expect = 4.803e-93
Identity = 21/56 (37.50%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  641 EKSLGEYREKIPSEVAKEIEDAVADLRKAMGADNVDDIKSKLDAANKAVSKIGQHM 808
            EK+L E+  K+     + IEDA++DLR+A+  D+ + IK+K +   +A  K+G+ M
Sbjct:  542 EKALAEHGSKVDESERRSIEDALSDLREALKGDDAEAIKAKSNTLAQASMKLGEAM 597          
The following BLAST results are available for this feature:
BLAST of DC900131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7M_PHAVU1.146e-10791.03Heat shock 70 kDa protein, mitochondrial OS=Phaseo... [more]
HSP7M_PEA5.690e-10789.69Heat shock 70 kDa protein, mitochondrial OS=Pisum ... [more]
HSP7M_SOLTU1.898e-9482.14Heat shock 70 kDa protein, mitochondrial OS=Solanu... [more]
DNAK_OLICO1.658e-9374.06Chaperone protein dnaK OS=Oligotropha carboxidovor... [more]
DNAK_NITWN1.658e-9374.06Chaperone protein dnaK OS=Nitrobacter winogradskyi... [more]
DNAK_BRUO24.803e-9372.17Chaperone protein dnaK OS=Brucella ovis (strain AT... [more]
DNAK_BRUME4.803e-9372.17Chaperone protein dnaK OS=Brucella melitensis GN=d... [more]
DNAK_BRUAB4.803e-9372.17Chaperone protein dnaK OS=Brucella abortus GN=dnaK... [more]
DNAK_RHOPT4.803e-9373.11Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]
DNAK_RHOPA4.803e-9373.11Chaperone protein dnaK OS=Rhodopseudomonas palustr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900131 VSS Citrus sinensis cDNA clone VS27V48 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900131 ID=DC900131|Name=DC900131|organism=Citrus sinensis|type=EST|length=1096bp
GTGGATGAGCNGCTTTTGGTTGGAGGAATGACCCGTGTGCCAAAGGTGCA
GGAAGTGGTCTCAGAAATCTTTGGTAAGAGTCCAAGCAAGGGAGTAAATC
CTGATGAGGCAGTTGCCCTTGGTGCTGCTATTCAAGGTGGTATTCTTCGT
GNNGACGTCAAAGAGTTGCTTCTCTTGGATGTTACACCTCTGTCACTGGG
TATTGAGACACTAGGTGGTATCTTCACCAGGTTGATCAATCGCAACACAA
CTATTCCAACAAAGAAGAGTCAGGTCTTCTCAACAGCAGCTGATAACCAG
ACTCAGGTGGGGATTAAGGTGCTTCAAGGTGAGCGCGAAATGGCATCTGA
CAACAAGTCCCTAGGAGAGTTTGAACTTGTGGGCATTCCACCAGCTCCTA
GAGGCATGCCTCAGATTGAGGTCACATTTGACATTGATGCCAATGGTATT
GTCACTGTTTCTGCAAAGGACAAGGCCACTGGCAAGGAACAGCAAATTAC
CATCCGCTCATCTGGAGGTCTATCAGAGGATGAAATTGAGAAGATGGTTA
AGGAAGCAGAATTGCATGCCCAGAGGGATAATGAAAGAAAAGCTCTGATT
GATATCAGAAACCAGGCGGATACCACCATCTACAGCATTTGAGAAGAGCT
TGGGTGAGTACAGAGAAAAGATTCCCAGTGAGGTTGCAAAAGAGATTGAG
GATGCTGTTGCAGATTTGAGAAAGGCCATGGGAGCTGACAATGTTGATGA
TATCAAGTCCAAGCTTGATGCAGCTAACAAAGCTGTCTCTAAGATTGGAC
AACACATGGCTGGTGGTTCTGGTGGTGGTGCTGGTTCTGGAGGTTCCCAG
GGTGGTGAACAGACTCCCGAGGCTGAGTATGAGGAGGTGAAAAAGTGAGC
ACAGAGGTAGTAAATTTCGTTCGTTGATGCTTCAAAAGGAGTCGGACATT
CANGAATGAGTCTTGTTTTGATTTGTAGTTTTAGGATATATGGCGGTTTT
GTATCTAAATTTTTATTTATTCAAGTTGTTAGGATAACGTTTTACTTTAT
TTTGAGAAACTGCACGAGCAAGTTAAAACCCTTTCCGGTGTATGGT
back to top