DC900129

Overview
NameDC900129
Unique NameDC900129
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1177
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig755 contig Csv1_Contig755:101..1276. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_RAT (Aldose 1-epimerase OS=Rattus norvegicus GN=Galm PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.716e-67
Identity = 82/174 (47.13%), Postives = 112/174 (64.37%), Query Frame = 3
Query:   57 EVFELNNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            E F+L +  + V I ++G  IT+L V D  G  +DVVLGF  +E Y++   P+FG +VGRVANRI  G+F++DG EY LPIN+ PNSLHGGF+GFDKV+W       G    + F   S DGEEGYPG++ V  TYTL     + ++  A   ++ TP++L  H+Y+NLAG  S
Sbjct:   20 EKFQLRSDQLNVDIISWGCTITALQVKDRQGKASDVVLGFAELEGYLQ-KQPYFGAVVGRVANRIAKGRFTVDGKEYHLPINREPNSLHGGFRGFDKVLWTPQVLSNG----VQFSRVSPDGEEGYPGELKVWVTYTLDGGELV-VNYRA-QASQTTPVNLTNHSYFNLAGQGS 186          

HSP 2 Score: 121.324 bits (303), Expect = 2.716e-67
Identity = 62/157 (39.49%), Postives = 87/157 (55.41%), Query Frame = 1
Query:  583 NILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXX-HSGVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEFSV 1050
            +I DH + I      PVD+  +PTG I PV+GT FD     ++G  +      G+DHN+ L   +EK   K  A++   ++ R+L ++T  PG+QFYT                  HSG CLETQ +P+A+NQP FP  ++RPGE Y HT  F+FSV
Sbjct:  188 DIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGKHLQSYHIHGFDHNFCLKESKEK---KFCARVHHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKSGEVYPKHSGFCLETQNWPDAVNQPQFPPILLRPGEEYNHTTWFKFSV 341          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_MOUSE (Aldose 1-epimerase OS=Mus musculus GN=Galm PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.023e-67
Identity = 80/174 (45.98%), Postives = 110/174 (63.22%), Query Frame = 3
Query:   57 EVFELNNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            E F+L +  + V I ++G  IT+L V D  G  +DVVLGF  +E Y++   P+FG +VGRVANRI  G+F++ G EY LP+N+ PNSLHGGF GFDKV+W       G    + F   S DGEEGYPG++ V  TYTL     + ++  A   ++ TP++L  H+Y+NLAG  S
Sbjct:   20 EKFQLRSDQLSVDIISWGCTITALQVKDRQGKASDVVLGFAELEGYLQ-KQPYFGAVVGRVANRIAKGRFTIGGKEYHLPVNREPNSLHGGFTGFDKVLWTPQVLTNG----VQFFRVSPDGEEGYPGELKVWVTYTLDGGELV-INYRA-QASQTTPVNLTNHSYFNLAGQGS 186          

HSP 2 Score: 125.176 bits (313), Expect = 6.023e-67
Identity = 62/157 (39.49%), Postives = 90/157 (57.32%), Query Frame = 1
Query:  583 NILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXX-HSGVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEFSV 1050
            NI DH + I      PVD+  +PTG I PV+GT FD     ++G  + +    G+DHN+ L   +EK   K  A+++  ++ R+L ++T  PG+QFYT                  HSG+CLETQ +P+++NQP FP  ++RPGE Y HT  F+FSV
Sbjct:  188 NIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGTHLQDYHIHGFDHNFCLKESKEK---KFCARVRHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKFSV 341          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_PIG (Aldose 1-epimerase OS=Sus scrofa GN=GALM PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 7.855e-67
Identity = 81/174 (46.55%), Postives = 109/174 (62.64%), Query Frame = 3
Query:   57 EVFELNNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            E F+L +  ++V I ++G  IT+L V D  G  +DVVLGF  ++ Y++   P+FG +VGRVANRI  G F+LDG EY L IN  PNSLHGG +GFDKV+W       G    I F   S DGEEGYPG++ V  TYTL     + ++  A   ++ TP++L  H+Y+NLAG  S
Sbjct:   20 EKFQLQSDQLRVDIISWGCTITALEVKDRQGRASDVVLGFAELKEYLQ-KHPYFGAVVGRVANRIAKGTFTLDGKEYKLAINNGPNSLHGGVRGFDKVLWTPRVLSNG----IEFSRVSPDGEEGYPGELKVWVTYTLDGGELV-VNYRA-QASQTTPVNLTNHSYFNLAGQGS 186          

HSP 2 Score: 127.102 bits (318), Expect = 7.855e-67
Identity = 65/157 (41.40%), Postives = 88/157 (56.05%), Query Frame = 1
Query:  583 NILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXX-HSGVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEFSV 1050
            NI DH + I      PVD+  +PTGEI PV+GT FD     ++G  + E    G+DHN+ L   +EK   +  A++    + RVL ++T  PG+QFYT                  HSG CLETQ +PNA+NQP+FP  +++PGE Y HT  F FSV
Sbjct:  188 NIYDHEVTIEADAFLPVDETLIPTGEIAPVQGTAFDLRKPVELGKHLQEFHINGFDHNFCLKRSKEK---QFCARVHHAGSGRVLEVYTTQPGIQFYTGNFLDGTLKGKTGAVYPKHSGFCLETQNWPNAVNQPHFPPVLLKPGEEYNHTTWFVFSV 341          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_BOVIN (Aldose 1-epimerase OS=Bos taurus GN=GALM PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.742e-66
Identity = 82/174 (47.13%), Postives = 109/174 (62.64%), Query Frame = 3
Query:   57 EVFELNNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            E F+L +  ++V I ++G  IT+L V D  G  +DVVLGFD +E Y++   P+FG +VGRVANRI  G F+LDG EY L IN  PNSLHGG KGFDKV+W       G    + F   S DGEEGYPG++ V   YTL     + ++  A   ++ TP++L  H+Y+NLAG  S
Sbjct:   20 EKFQLQSDQLRVDIISWGCTITALEVKDRQGRASDVVLGFDELEGYLQ-KQPYFGAVVGRVANRIAKGTFTLDGKEYKLAINNGPNSLHGGVKGFDKVLWTPRVLSNG----VEFSRVSPDGEEGYPGELKVWVMYTLDGGELV-VNYRA-QASQTTPVNLTNHSYFNLAGQGS 186          

HSP 2 Score: 122.865 bits (307), Expect = 1.742e-66
Identity = 63/157 (40.13%), Postives = 88/157 (56.05%), Query Frame = 1
Query:  583 NILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXX-HSGVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEFSV 1050
            NI DH + I      PVD+  +PTGEI  V+GT FD     ++G  + E    G+DHN+ L   +EK   +  A++    + RVL ++T  PG+QFYT                  HSG CLETQ +P+A+NQP+FP  +++PGE Y HT  F+FSV
Sbjct:  188 NIYDHEVTIEADAFLPVDEVLIPTGEIASVQGTAFDLRKPVELGKHLQEFHVNGFDHNFCLKGSKEK---RFCARVHHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKSGAGYPKHSGFCLETQSWPDAVNQPHFPPVLLKPGEEYDHTTWFKFSV 341          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_HUMAN (Aldose 1-epimerase OS=Homo sapiens GN=GALM PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 5.036e-66
Identity = 80/174 (45.98%), Postives = 109/174 (62.64%), Query Frame = 3
Query:   57 EVFELNNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            E F+L +  ++V I ++G  IT+L V D  G  +DVVLGF  +E Y++   P+FG ++GRVANRI  G F +DG EY L INK PNSLHGG +GFDKV+W       G    + F   S DGEEGYPG++ V  TYTL     + ++  A   ++ TP++L  H+Y+NLAG  S
Sbjct:   20 EKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQ-KQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNG----VQFSRISPDGEEGYPGELKVWVTYTLDGGELI-VNYRA-QASQATPVNLTNHSYFNLAGQAS 186          

HSP 2 Score: 124.02 bits (310), Expect = 5.036e-66
Identity = 63/157 (40.13%), Postives = 88/157 (56.05%), Query Frame = 1
Query:  583 NILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXX-HSGVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEFSV 1050
            NI DH + I      PVD+  +PTGE+ PV+GT FD     ++G  + +    G+DHN+ L   +EK      A++   ++ RVL ++T  PG+QFYT                  HSG CLETQ +P+A+NQP FP  ++RPGE Y HT  F+FSV
Sbjct:  188 NINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKH---FCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSV 341          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_PONAB (Aldose 1-epimerase OS=Pongo abelii GN=GALM PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.117e-65
Identity = 81/174 (46.55%), Postives = 109/174 (62.64%), Query Frame = 3
Query:   57 EVFELNNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            E F+L +  ++V I ++G  IT+L V D  G  +DVVLGF  +E Y++   P+FG ++GRVANRI  G F +DG EY L INK PNSLHGG +GFDKV+W       G    I F   S DGEEGYPG++ V  TYTL     + ++  A   ++ TP++L  H+Y+NLAG  S
Sbjct:   20 EKFQLQSDLLRVDIISWGCTITALEVKDRQGRSSDVVLGFAELEGYLQ-KQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNG----IQFSRISPDGEEGYPGELKVWVTYTLDGGELV-VNYRA-QASQATPVNLTNHSYFNLAGQGS 186          

HSP 2 Score: 122.479 bits (306), Expect = 1.117e-65
Identity = 62/157 (39.49%), Postives = 87/157 (55.41%), Query Frame = 1
Query:  583 NILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXX-HSGVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEFSV 1050
            NI DH + I      PVD+  +PTGE+ PV+GT FD     ++G  + +    G+DHN+ L   +EK      A++   ++ RVL ++T  PG+QFY                   HSG CLETQ +P+A+NQP FP  ++RPGE Y HT  F+FSV
Sbjct:  188 NIYDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKH---FCARVHHAASGRVLEVYTTQPGVQFYMGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSV 341          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_ACICA (Aldose 1-epimerase OS=Acinetobacter calcoaceticus GN=mro PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.375e-50
Identity = 66/170 (38.82%), Postives = 98/170 (57.65%), Query Frame = 3
Query:   72 NNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAP---FFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAE-YKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAG 569
            NN  + V   ++G +IT +  PD  G   ++VLGFD ++ Y          FG ++GR ANRI + KFSLDG  Y L  N  PNSLH G  GFDK VW+V     KGE    + K  S +G++G+PG + V   Y+L+     +++ +A   ++PT ++L  H+Y+NL+G
Sbjct:   44 NNNGVSVSFISFGGVITQILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNLEKNNGPNSLHSGNPGFDKRVWQVKPLVSKGETVKASLKLTSPNGDQGFPGKLDVEVIYSLSDQNEFKIEYKA-KTDQPTVVNLTNHSYFNLSG 212          

HSP 2 Score: 93.9745 bits (232), Expect = 1.375e-50
Identity = 55/162 (33.95%), Postives = 81/162 (50.00%), Query Frame = 1
Query:  586 ILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINE-----VPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXXHS-GVCLETQGFPNAINQPNFPSXVVRPGESYQHTMLFEFSVE 1053
            +LDH +Q+    I   DQN++PTGEI  V GTPFDF   K I   I         G GYD  +V++  + +  L  AA + +P + R + + T  P +Q YT                  +  + LETQ FP++ NQP FPS  + P ++Y    +F+F V+
Sbjct:  220 VLDHVVQLNAGRILVTDQNSLPTGEIASVAGTPFDFRMPKAIVKDIRANNQQLAYGYGYDQTWVIN-QKSQGKLNLAAIVVDPKSKRTMQVLTTEPSVQMYTADHLLGNIVGANGVLYRQADALALETQHFPDSPNQPTFPSTRLNPNQTYNSVTVFKFGVQ 380          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_SHIFL (Aldose 1-epimerase OS=Shigella flexneri GN=galM PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.710e-38
Identity = 58/169 (34.32%), Postives = 90/169 (53.25%), Query Frame = 3
Query:   72 NNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            NN  M V + ++GA + S  +P   G+  + +LG  S E Y   AA F G  +GR ANRI + +++ DG   TL  ++  N LHGG +GFDK  W++       +  + F   S DG++G+PG++     Y LT    + +   A  + KP P+++  H Y+NL G  S
Sbjct:   22 NNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPECYQDQAA-FLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ---NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVD-KPCPVNMTNHVYFNLDGEQS 185          

HSP 2 Score: 72.7886 bits (177), Expect = 4.710e-38
Identity = 47/165 (28.48%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  577 QGNILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIG----ASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXXHSGVCLETQGFPNAINQPNF--PSXVVRPGESYQHTMLFEFSVE 1053
            Q ++ +H +QI      PVD+  +P   +  V GT FDF + K I     A  ++    GYDH ++L    +  G K AA +        L ++T AP +QFY+                   G+ LE++  P++ N P +  P   +RPGE Y     ++F  E
Sbjct:  184 QSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRKVKGYDHAFLLQA--KGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAE 346          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GALM_ECOLI (Aldose 1-epimerase OS=Escherichia coli (strain K12) GN=galM PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.710e-38
Identity = 58/169 (34.32%), Postives = 90/169 (53.25%), Query Frame = 3
Query:   72 NNGSMQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKPTPISLAQHTYWNLAGHHS 578
            NN  M V + ++GA + S  +P   G+  + +LG  S E Y   AA F G  +GR ANRI + +++ DG   TL  ++  N LHGG +GFDK  W++       +  + F   S DG++G+PG++     Y LT    + +   A  + KP P+++  H Y+NL G  S
Sbjct:   22 NNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPECYQDQAA-FLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ---NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVD-KPCPVNMTNHVYFNLDGEQS 185          

HSP 2 Score: 72.7886 bits (177), Expect = 4.710e-38
Identity = 47/165 (28.48%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  577 QGNILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIG----ASINEVPGLGYDHNYVLDCGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXXHSGVCLETQGFPNAINQPNF--PSXVVRPGESYQHTMLFEFSVE 1053
            Q ++ +H +QI      PVD+  +P   +  V GT FDF + K I     A  ++    GYDH ++L    +  G K AA +        L ++T AP +QFY+                   G+ LE++  P++ N P +  P   +RPGE Y     ++F  E
Sbjct:  184 QSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRKVKGYDHAFLLQA--KGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAE 346          
BLAST of DC900129 vs. ExPASy Swiss-Prot
Match: GAL10_SCHPO (Bifunctional protein gal10 OS=Schizosaccharomyces pombe GN=gal10 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.055e-24
Identity = 56/167 (33.53%), Postives = 88/167 (52.69%), Query Frame = 3
Query:   84 MQVKITNYGAIITSLSVPDXHGNWADVVLGFDSVEPYVKGAAPFFGCIVGRVANRIKDGKFSLDGVEYTLPINK-PPNSLHGGFKGFDK--VVWEVAEYKKGENPSITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRLDMEAVPENKP---TPISLAQHTYWNLA 566
            ++V I NYGA++ ++     +     +V GF+    Y     PFFG  +GR ANRI +G+F +DG  YTL  N+    +LHGG  GFDK   +  +A   +  N ++ F    +DG  G+P D+  +  YT+ +++        +PE      T ++L  H+YWNLA
Sbjct:  378 LEVSIANYGALVQAVRYKGRN-----LVNGFNDFSRYKLKENPFFGATIGRFANRIANGQFEVDGHLYTLCKNENNKTTLHGGNNGFDKQFFLGPIARQYEDYN-TLEFILVDKDGNNGFPSDLETLVKYTIKNNSLEIEYKSVIPEYSKLNVTAVNLTNHSYWNLA 538          

HSP 2 Score: 41.2022 bits (95), Expect = 2.055e-24
Identity = 44/183 (24.04%), Postives = 74/183 (40.44%), Query Frame = 1
Query:  574 IQGNILDHSIQIWGSHITPVDQNTVPTGEIMPVKGTPFDFTTEKKIGASINEVPGLGYDHNYVLD-------CGEEKSGLKHAAKLKEPSTSRVLNLWTNAPGMQFYTXXXXXXXXXXXXXXXXXHSGVCLETQGFPNAINQPNFPSXVV-RPGESY---QHTMLFEFSVE*TISLLKSSSWN 1089
            I G I+  +  ++   +    + ++PTG+I+  +    D T   K+       P + +D+ +++D           K  LK+  ++  PS    L + T  P  Q YT                  SG C+ET  F NA+N   +   V+ R GE Y       L+   +E     L S+S+N
Sbjct:  544 IDGTIIKSTTNVY---LKVNSETSLPTGDIVEWQN---DITKPTKLD------PNISFDNCFIVDREASKFCLDTRKYSLKNIVEVIHPSVPVKLVVSTTEPAFQLYTGDGNDICEFQS------RSGFCVETGRFINALNNEKWSKQVILRKGEVYGARSKFSLYAQDLEENKHFLDSASYN 708          
The following BLAST results are available for this feature:
BLAST of DC900129 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
GALM_RAT2.716e-6747.13Aldose 1-epimerase OS=Rattus norvegicus GN=Galm PE... [more]
GALM_MOUSE6.023e-6745.98Aldose 1-epimerase OS=Mus musculus GN=Galm PE=2 SV... [more]
GALM_PIG7.855e-6746.55Aldose 1-epimerase OS=Sus scrofa GN=GALM PE=2 SV=1[more]
GALM_BOVIN1.742e-6647.13Aldose 1-epimerase OS=Bos taurus GN=GALM PE=2 SV=1[more]
GALM_HUMAN5.036e-6645.98Aldose 1-epimerase OS=Homo sapiens GN=GALM PE=1 SV... [more]
GALM_PONAB1.117e-6546.55Aldose 1-epimerase OS=Pongo abelii GN=GALM PE=2 SV... [more]
GALM_ACICA1.375e-5038.82Aldose 1-epimerase OS=Acinetobacter calcoaceticus ... [more]
GALM_SHIFL4.710e-3834.32Aldose 1-epimerase OS=Shigella flexneri GN=galM PE... [more]
GALM_ECOLI4.710e-3834.32Aldose 1-epimerase OS=Escherichia coli (strain K12... [more]
GAL10_SCHPO2.055e-2433.53Bifunctional protein gal10 OS=Schizosaccharomyces ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900129 VSS Citrus sinensis cDNA clone VS27V46 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900129 ID=DC900129|Name=DC900129|organism=Citrus sinensis|type=EST|length=1177bp
ATTAGTACTCAAATTTCACAACAAAGAGAAAAATGGCTGATCATACATTA
AAACCAGAAGTGTTTGAACTGAACAATGGAAGCATGCAAGTCAAAATTAC
CAATTATGGAGCCATTATCACCTCACTTTCTGTACCTGACANACATGGAA
ATTGGGCTGACGTTGTTCTTGGATTCGACTCTGTCGAACCATACGTGAAA
GGTGCTGCACCTTTTTTTGGCTGCATTGTGGGTAGGGTTGCTAACAGAAT
TAAAGATGGGAAGTTTTCTCTCGACGGGGTTGAATACACTTTGCCCATCA
ACAAGCCACCAAACAGTCTCCATGGTGGGTTCAAGGGTTTTGATAAAGTT
GTCTGGGAGGTAGCAGAATATAAGAAAGGTGAAAACCCTTCCATTACTTT
CAAGTATCGCAGCCGTGATGGCGAGGAAGGTTACCCAGGGGATGTTTCTG
TGATGGCAACCTACACACTAACATCAAGCACGACAATGAGGCTTGACATG
GAAGCAGTTCCAGAAAACAAGCCGACCCCAATCAGTTTAGCTCAACACAC
GTACTGGAACTTAGCAGGCCATCATTCAGGGGAACATACTTGACCACTCA
ATTCAAATATGGGGATCACACATTACTCCTGTAGATCAGAACACGGTCCC
AACTGGAGAAATTATGCCAGTCAAGGGCACCCCTTTTGATTTCACCACTG
AGAAAAAGATTGGTGCATCAATCAATGAAGTACCTGGTTTAGGGTATGAT
CACAACTATGTTCTTGATTGTGGAGAAGAGAAATCAGGTCTGAAACATGC
TGCAAAACTGAAGGAACCATCAACCTCAAGGGTCCTTAATTTATGGACCA
ATGCCCCAGGCATGCAGTTTTACACTGGTAACTATGTTAACGGAGTTGTT
GGAAAGGGGGGTGCAGTTTATGGAAAGCACTCAGGTGTCTGCTTGGAGAC
GCAGGGGTTTCCTAACGCCATAAATCAACCTAACTTCCCTTCTGNTGTGG
TTCGACCCGGTGAGAGCTACCAACATACTATGTTGTTTGAGTTTTCAGTT
GAGTGAACTATTAGTCTCTTGAAGAGTAGTTCTTGGAATAAGGTTATTGT
TCATGGGTTTGCATACCATGGCGAGTACTGATGTTTGGATGTTGGCTAAA
TCTAAATAATAAAATAATATTATAAGA
back to top