DC900127

Overview
NameDC900127
Unique NameDC900127
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length688
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12042 contig Csv1_Contig12042:451..1138. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: EBF1_ARATH (EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 4.377e-89
Identity = 157/229 (68.56%), Postives = 190/229 (82.97%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNLGV 687
            EKL+L +C  ITD+ L+ IAK+CP L +LT+E+CS IG+EGL A+ R C  LKS+SIK+C LV DQGIASLLS+ T SL K+KLQ LN+TDVSLAV+GHYG+++TDL L GL HVSE+GFWVMG+G GLQKL SLTIT+C GVTD+GLE+VGKGCPN+K+  + K   LSDNGL+SFAKA+ SLESLQLEECHR+TQ GFFGSLLNCGEK KA SLV+CL I+D   G+
Sbjct:  206 EKLELNRCSTITDKGLVAIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTITACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGL 434          

HSP 2 Score: 67.781 bits (164), Expect = 6.252e-11
Identity = 55/225 (24.44%), Postives = 100/225 (44.44%), Query Frame = 1
Query:   22 CPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLN---ITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNLGV 687
            C  ++ + L  ++    K ID+     S I  +G    G    +L      D RL       ++ ++    L K+ ++  N   ++D+ L  IG    ++  L L  +  +++ G  ++    G  +L+ L +  C  +TD GL A+ K CPNL +  L  C+ + D GL++ A++   L+S+ ++ C  +   G    L N       L L   L + D +L V
Sbjct:   88 CAFVSKQWLTLVSSIRQKEIDVP----SKITEDGDDCEGCLSRSLDGKKATDVRLAA----IAVGTAGRGGLGKLSIRGSNSAKVSDLGLRSIGRSCPSLGSLSLWNVSTITDNG--LLEIAEGCAQLEKLELNRCSTITDKGLVAIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKL-QMLNVTDVSLAV 301          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: EBF2_ARATH (EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 5.930e-78
Identity = 141/226 (62.39%), Postives = 172/226 (76.11%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQN 678
            EKLDL +CP ITD  L+ IA+NC  L DLTI+SCS +GNEGL+A+ R C NL+SISI+ C  +GDQG+A LL+ A   L KVKLQ LN++ +SLAVIGHYG AVTDL L GL  V+E+GFWVMG+  GL+KLKSL++ SC G+TD+GLEAVG GCP+LK   L KC  +S  GL++ AK+A SLESL+LEECHRI Q G  G L+NCG K KA SL +CLGI D N
Sbjct:  196 EKLDLSRCPGITDSGLVAIAENCVNLSDLTIDSCSGVGNEGLRAIARRCVNLRSISIRSCPRIGDQGVAFLLAQAGSYLTKVKLQMLNVSGLSLAVIGHYGAAVTDLVLHGLQGVNEKGFWVMGNAKGLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLMGFLMNCGSKLKAFSLANCLGISDFN 421          

HSP 2 Score: 71.633 bits (174), Expect = 4.329e-12
Identity = 68/238 (28.57%), Postives = 104/238 (43.70%), Query Frame = 1
Query:   58 AKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQ---RLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLK--QFC-------------------------LRKCAFLSDNGLISFAKA-AFSLESLQLEECHRITQLGFFGSLLNC---GEKXKALSLVSCLGIK 669
            AK   KL  L++ SC  + + GL+AVG  CP+LK +S+  C LV  +G+ +L  SA  SLE +KL+   R+N   + +  + + G  +    L     +S+              L+SL+I  C G  D  L  +GK C  L+  + C                         L +C  +SDN + + +     +LESL L+ C  IT         NC    +   + +LVS  GIK
Sbjct:  321 AKGLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSAL-SLESLKLEECHRINQFGL-MGFLMNCGSKLKAFSLANCLGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLAFLGKFCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTLESLNLDGCKNITNASLVAVAKNCYSVNDLDISNTLVSDHGIK 556          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FBL4_ARATH (F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.907e-21
Identity = 71/251 (28.29%), Postives = 118/251 (47.01%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKL-QRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSG-HGLQKLK----------------------SLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNL 681
            E L L  CP ++   L ++A+ C  L  L ++ C  +G++GL AVG+FC  L+ ++++ C  + D G+  L+   + SL+ + +     ITD+SL  +G +   +  L+L    ++ ++G   +  G H L+ LK                       L + S    TD G+ A+GKG   LK   L  C F+S  GL + A     LE +++  CH I   G      +C  + K L+L+ C  I +  L
Sbjct:  143 ENLSLIWCPNVSSVGLCSLAQKCTSLKSLDLQGCY-VGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCSKSLKSIGVAASAKITDLSLEAVGSHCKLLEVLYLDS-EYIHDKGLIAVAQGCHRLKNLKLQCVSVTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEINGCHNIGTRGIEAIGKSC-PRLKELALLYCQRIGNSAL 390          

HSP 2 Score: 100.908 bits (250), Expect = 6.664e-21
Identity = 62/223 (27.80%), Postives = 110/223 (49.33%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQR-LNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGI 666
            E++++  C  I  R +  I K+CP+L +L +  C  IGN  LQ +G+ C +L+ + + DC  +GD  + S ++    +L+K+ ++R   I +  +  IG +  ++T+L L     V  +    +G G  LQ+   L ++ C  ++D G+ A+ +GCP L    +     + D  L    +    L+ L L  CH IT  G    +  C +  +   +V C GI
Sbjct:  349 ERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCS-IAKGCRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFCDKVGNKALIAIGKGCSLQQ---LNVSGCNQISDAGITAIARGCPQLTHLDISVLQNIGDMPLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKC-KLLETCHMVYCPGI 566          

HSP 3 Score: 89.3521 bits (220), Expect = 2.006e-17
Identity = 60/214 (28.04%), Postives = 96/214 (44.86%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKAL 642
            E L L  C  I D A+ +IAK C  L  L I  C  IGN+G+ ++G+ C +L  +S++ C  VG++ + ++    +       LQ+LN+                    +G   +S+ G  +     G  +L  L I+    + D+ L  +G+GCP LK   L  C  ++DNGL    +    LE+  +  C  IT  G    + +C    K L
Sbjct:  401 EILHLVDCSGIGDIAMCSIAKGCRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFCDKVGNKALIAIGKGCS-------LQQLNV--------------------SGCNQISDAG--ITAIARGCPQLTHLDISVLQNIGDMPLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKCKLLETCHMVYCPGITSAGVATVVSSCPHIKKVL 585          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FXL20_HUMAN (F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 1.137e-20
Identity = 70/228 (30.70%), Postives = 113/228 (49.56%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLN-ITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNL 681
            E L+L  C   TD    +++K C KL  L + SC+SI N  L+A+   CP L+ ++I  C  V   GI +L+      L+ + L+    + D +L  IG +   +  L L     +++ G   +    G  KL+SL  + C  +TD  L A+G+ CP L+   + +C+ L+D G  + A+    LE + LEEC +IT        ++C  + + LSL  C  I D  +
Sbjct:  120 EVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCG-GLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC--RGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGI 343          

HSP 2 Score: 77.0258 bits (188), Expect = 1.030e-13
Identity = 58/223 (26.01%), Postives = 99/223 (44.39%), Query Frame = 1
Query:    7 LDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGI----ASLLSSATYSLEKV----------------KLQRL------NITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFS---LESLQLEECHRIT 588
            LDL  C +IT+ +L  +++ CP L  L I  C  +  +G+QA+ R C  LK++ +K C  + D+ +    A      T +L+                  KLQ L      NITD  L  +G     +  L +     +++ GF  +       +L+ + +  C+ +TD  L  +   CP L+   L  C  ++D+G+      A +   LE ++L+ C  IT
Sbjct:  148 LDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLA--RNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLIT 368          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FXL20_BOVIN (F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 1.137e-20
Identity = 70/228 (30.70%), Postives = 113/228 (49.56%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLN-ITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNL 681
            E L+L  C   TD    +++K C KL  L + SC+SI N  L+A+   CP L+ ++I  C  V   GI +L+      L+ + L+    + D +L  IG +   +  L L     +++ G   +    G  KL+SL  + C  +TD  L A+G+ CP L+   + +C+ L+D G  + A+    LE + LEEC +IT        ++C  + + LSL  C  I D  +
Sbjct:  120 EVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCG-GLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC--RGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGI 343          

HSP 2 Score: 77.0258 bits (188), Expect = 1.030e-13
Identity = 58/223 (26.01%), Postives = 99/223 (44.39%), Query Frame = 1
Query:    7 LDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGI----ASLLSSATYSLEKV----------------KLQRL------NITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFS---LESLQLEECHRIT 588
            LDL  C +IT+ +L  +++ CP L  L I  C  +  +G+QA+ R C  LK++ +K C  + D+ +    A      T +L+                  KLQ L      NITD  L  +G     +  L +     +++ GF  +       +L+ + +  C+ +TD  L  +   CP L+   L  C  ++D+G+      A +   LE ++L+ C  IT
Sbjct:  148 LDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLA--RNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLIT 368          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FXL20_MOUSE (F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 1.485e-20
Identity = 70/228 (30.70%), Postives = 112/228 (49.12%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLN-ITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNL 681
            E L L  C   TD    +++K C KL  L + SC+SI N  L+A+   CP L+ ++I  C  V   GI +L+      L+ + L+    + D +L  IG +   +  L L     +++ G   +    G  KL+SL  + C  +TD  L A+G+ CP L+   + +C+ L+D G  + A+    LE + LEEC +IT        ++C  + + LSL  C  I D  +
Sbjct:  120 EVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCG-GLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC--RGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHC-PRLQVLSLSHCELITDDGI 343          

HSP 2 Score: 77.0258 bits (188), Expect = 1.030e-13
Identity = 58/223 (26.01%), Postives = 99/223 (44.39%), Query Frame = 1
Query:    7 LDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGI----ASLLSSATYSLEKV----------------KLQRL------NITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFS---LESLQLEECHRIT 588
            LDL  C +IT+ +L  +++ CP L  L I  C  +  +G+QA+ R C  LK++ +K C  + D+ +    A      T +L+                  KLQ L      NITD  L  +G     +  L +     +++ GF  +       +L+ + +  C+ +TD  L  +   CP L+   L  C  ++D+G+      A +   LE ++L+ C  IT
Sbjct:  148 LDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLA--RNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLIT 368          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FBXL2_PONAB (F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.485e-20
Identity = 66/227 (29.07%), Postives = 107/227 (47.14%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNL 681
            E L+L  C  ITD    ++++ C KL  L + SC SI N  L+ +   C NL+ +++  C  +   GI +L+         +      + D +L  I +Y   +  L L     +++ G  V+    G  +L++L ++ C  +TD  L A+G  CP L+     +C+ L+D G    A+    LE + LEEC  IT        ++C  K +ALSL  C  I D  +
Sbjct:  107 EHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEG--VVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIHC-PKLQALSLSHCELITDDGI 330          

HSP 2 Score: 78.5666 bits (192), Expect = 3.542e-14
Identity = 54/223 (24.22%), Postives = 103/223 (46.19%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRL-NITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFS---LESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSC 657
            E L+L  C  IT   +  + + C  L  L +  C+ + +E L+ +  +C  L S++++ C  + D+G+  +     + L+ + L    N+TD SL  +G     +  L      H+++ GF ++       +L+ + +  C+ +TD  L  +   CP L+   L  C  ++D+G++  + +      L  L+L+ C  IT +     L NC    + L L  C
Sbjct:  159 EYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGC-HRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLA--RNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA-LEHLENC-RGLERLELYDC 376          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FBXL2_HUMAN (F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 1.485e-20
Identity = 66/227 (29.07%), Postives = 107/227 (47.14%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNL 681
            E L+L  C  ITD    ++++ C KL  L + SC SI N  L+ +   C NL+ +++  C  +   GI +L+         +      + D +L  I +Y   +  L L     +++ G  V+    G  +L++L ++ C  +TD  L A+G  CP L+     +C+ L+D G    A+    LE + LEEC  IT        ++C  K +ALSL  C  I D  +
Sbjct:  107 EHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEG--VVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIHC-PKLQALSLSHCELITDDGI 330          

HSP 2 Score: 78.5666 bits (192), Expect = 3.542e-14
Identity = 54/223 (24.22%), Postives = 103/223 (46.19%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQRL-NITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFS---LESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSC 657
            E L+L  C  IT   +  + + C  L  L +  C+ + +E L+ +  +C  L S++++ C  + D+G+  +     + L+ + L    N+TD SL  +G     +  L      H+++ GF ++       +L+ + +  C+ +TD  L  +   CP L+   L  C  ++D+G++  + +      L  L+L+ C  IT +     L NC    + L L  C
Sbjct:  159 EYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGC-HRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLA--RNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA-LEHLENC-RGLERLELYDC 376          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FBXL7_MOUSE (F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.319e-20
Identity = 61/192 (31.77%), Postives = 95/192 (49.48%), Query Frame = 1
Query:    7 LDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASL--LSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEEC 576
            LD+  C  + D  L TIA +C +L  L +  C  + +EGL+ +  +C ++K +S+ DCR V D G+  +  L S    L      R  ITDV +  +  Y   +  L   G   +++ G   +       KLKSL I  C  V+D GLE++   C NLK+  L+ C  ++  GL   A   F L+ L +++C
Sbjct:  277 LDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGR--ITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKN--CTKLKSLDIGKCPLVSDTGLESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDC 464          

HSP 2 Score: 95.9005 bits (237), Expect = 2.144e-19
Identity = 72/256 (28.12%), Postives = 114/256 (44.53%), Query Frame = 1
Query:   22 CPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNL-----------------------------KSISIK-----DCRLVGDQGIASLLSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNLGV 687
            C  +TDR L TIA+ CP+L  L +  C +I NE +  V   CPNL                             K ISI+     DC ++ D+G+ ++ +  T        + + +TD  L  +  Y  ++ +L ++    VS+ G   +       +L+ L+I  C  +TD+G+  V K C  L+    R C  ++D+G+   AK    L+SL + +C  ++  G     LNC    K LSL SC  I  Q L +
Sbjct:  196 CRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLE--SRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLESLALNC-FNLKRLSLKSCESITGQGLQI 448          
BLAST of DC900127 vs. ExPASy Swiss-Prot
Match: FBXL7_HUMAN (F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.319e-20
Identity = 60/192 (31.25%), Postives = 95/192 (49.48%), Query Frame = 1
Query:    7 LDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISIKDCRLVGDQGIASL--LSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEEC 576
            LD+  C  + D  L TIA +C +L  L +  C  + +EGL+ +  +C ++K +S+ DCR V D G+  +  L S    L      R  +TDV +  +  Y   +  L   G   +++ G   +       KLKSL I  C  V+D GLE +   C NLK+  L+ C  ++  GL   A   F L++L +++C
Sbjct:  277 LDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGR--VTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKN--CTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDC 464          

HSP 2 Score: 95.9005 bits (237), Expect = 2.144e-19
Identity = 74/263 (28.14%), Postives = 117/263 (44.49%), Query Frame = 1
Query:    1 EKLDLCQCPAITDRALITIAKNCPKLIDLTIESCSSIGNEGLQAVGRFCPNL-----------------------------KSISIK-----DCRLVGDQGIASLLSSATYSLEKVKLQRLNITDVSLAVIGHYGMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKXKALSLVSCLGIKDQNLGV 687
            E + +  C  +TDR L TIA+ CP+L  L +  C +I NE +  V   CPNL                             K ISI+     DC ++ D+G+ ++ +  T        + + +TD  L  +  Y  ++ +L ++    VS+ G   +       +L+ L+I  C  VTD+G+  V K C  L+    R C  ++D+G+   AK    L+SL + +C  ++  G     LNC    K LSL SC  I  Q L +
Sbjct:  189 ETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLE--SRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNC-FNLKRLSLKSCESITGQGLQI 448          
The following BLAST results are available for this feature:
BLAST of DC900127 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
EBF1_ARATH4.377e-8968.56EIN3-binding F-box protein 1 OS=Arabidopsis thalia... [more]
EBF2_ARATH5.930e-7862.39EIN3-binding F-box protein 2 OS=Arabidopsis thalia... [more]
FBL4_ARATH3.907e-2128.29F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana... [more]
FXL20_HUMAN1.137e-2030.70F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBX... [more]
FXL20_BOVIN1.137e-2030.70F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL2... [more]
FXL20_MOUSE1.485e-2030.70F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbx... [more]
FBXL2_PONAB1.485e-2029.07F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL... [more]
FBXL2_HUMAN1.485e-2029.07F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL... [more]
FBXL7_MOUSE4.319e-2031.77F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl... [more]
FBXL7_HUMAN4.319e-2031.25F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900127 VSS Citrus sinensis cDNA clone VS27V45 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900127 ID=DC900127|Name=DC900127|organism=Citrus sinensis|type=EST|length=688bp
GAGAAGCTTGACCTTTGCCAGTGTCCTGCTATTACTGACCGAGCTTTGAT
CACAATTGCAAAGAACTGCCCTAAATTGATTGATCTGACAATAGAGTCTT
GCTCAAGCATCGGAAATGAAGGTCTGCAGGCTGTTGGGAGATTCTGCCCC
AATCTGAAGTCCATTTCAATCAAGGATTGCCGCCTTGTTGGGGATCAAGG
GATTGCTAGTTTGTTGTCTTCAGCCACTTATTCTCTGGAGAAAGTGAAGC
TGCAAAGGTTGAACATTACTGATGTTTCTCTTGCTGTTATTGGACACTAT
GGCATGGCAGTTACTGATCTCTTCCTTACTGGCCTTCCACATGTGAGTGA
GAGAGGCTTCTGGGTTATGGGCAGTGGTCATGGGTTGCAAAAATTGAAGT
CCTTGACAATTACATCATGCATGGGAGTAACGGATTTGGGCCTTGAAGCT
GTGGGCAAGGGGTGCCCAAATTTGAAGCAGTTCTGCCTCCGAAAATGTGC
CTTTTTATCTGACAATGGACTGATCTCTTTTGCTAAAGCTGCTTTCTCAC
TTGAAAGCCTTCAGTTGGAAGAGTGCCACAGGATCACCCAACTTGGGTTT
TTTGGTTCCCTTTTAAACTGTGGTGAAAAGNTGAAGGCTTTATCATTGGT
GAGCTGCTTGGGGATTAAGGATCAAAATCTGGGTGTCC
back to top