DC900126

Overview
NameDC900126
Unique NameDC900126
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length309
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900126 vs. ExPASy Swiss-Prot
Match: P1_ARATH (Probable NADP-dependent oxidoreductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.580e-13
Identity = 33/46 (71.74%), Postives = 40/46 (86.96%), Query Frame = 3
Query:    3 IIPHIKEGKIVYVEDMAEGLESAPAALIGLFSGRNVGKQVVAVAPE 140
            ++PHI+EGKI YVED+A+GLE AP AL+GLF G+NVGKQVV VA E
Sbjct:  300 VLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE 345          
BLAST of DC900126 vs. ExPASy Swiss-Prot
Match: P2_ARATH (Probable NADP-dependent oxidoreductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.777e-12
Identity = 32/46 (69.57%), Postives = 39/46 (84.78%), Query Frame = 3
Query:    3 IIPHIKEGKIVYVEDMAEGLESAPAALIGLFSGRNVGKQVVAVAPE 140
            ++P IKEGKI YVED+A+GLE AP AL+GLF G+NVGKQVV +A E
Sbjct:  298 VLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVIARE 343          
The following BLAST results are available for this feature:
BLAST of DC900126 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
P1_ARATH3.580e-1371.74Probable NADP-dependent oxidoreductase P1 OS=Arabi... [more]
P2_ARATH1.777e-1269.57Probable NADP-dependent oxidoreductase P2 OS=Arabi... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900126 VSS Citrus sinensis cDNA clone VS27V44 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900126 ID=DC900126|Name=DC900126|organism=Citrus sinensis|type=EST|length=309bp
TGATCATTCCTCACATCAAAGAAGGGAAGATTGTATATGTCGAAGACATG
GCTGAAGGTCTCGAGAGTGCTCCGGCTGCTCTCATCGGTCTATTCTCTGG
CCGGAATGTTGGGAAACAGGTGGTTGCAGTTGCTCCTGAATGAAGAATAA
GTTAGTGTTGCATGTTCTTTTACCCTTTGACACAAACTTCAATGTGAAAG
AGAGAATGCTGCTCATACTGCTTTATAAAACAATCAAATGAGTGCAAGTT
TCATGGTGTTTGCTGAATCAAATATTGGAAATTAAGCAGCTAGACCTATC
TCCTTCTTG
back to top