DC900125

Overview
NameDC900125
Unique NameDC900125
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1127
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900125 vs. ExPASy Swiss-Prot
Match: YLBA_ECOLI (Uncharacterized protein ylbA OS=Escherichia coli (strain K12) GN=ylbA PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.305e-17
Identity = 54/180 (30.00%), Postives = 91/180 (50.56%), Query Frame = 3
Query:  267 VERFIFVVQGSAMLTNASGVSSKLMVDSYTYLPPNFAHSL---RAEGSATLVVFERRYASLENHITEQIVGSTDKQPLLETPG-EVFQLRKLLPQAVPFDFNIHIMDFQPGEFLNVKEVHYNQHGLLLLEGQGIYRLGDSWYPVQAGDVLWMAPFVPQWYAALGKTRT-RYLLYKDVNRN 791
            +E F++V+ G+ +   A G +  L    Y Y PP    +    +AE S  + +++RRY  +E +    + G+  +   +   G +   L   LP+ + FD N+HI+ F PG      E H  +HG  +L GQG+Y L ++W PV+ GD ++M  +  Q    +G+     Y+  KD NR+
Sbjct:   81 IETFLYVISGN-ITAKAEGKTFALSEGGYLYCPPGSLMTFVNAQAEDSQ-IFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMDDVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPVKKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRD 258          
The following BLAST results are available for this feature:
BLAST of DC900125 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
YLBA_ECOLI3.305e-1730.00Uncharacterized protein ylbA OS=Escherichia coli (... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900125 VSS Citrus sinensis cDNA clone VS27V42 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900125 ID=DC900125|Name=DC900125|organism=Citrus sinensis|type=EST|length=1127bp
CCCCCGTCCCCGAGTTCGTTCCATCTCAGTATCTCATATCAGTACAGTCA
CTACCTCAAAATATGCAGAGCCCCCAAGTTCTTCTTGTCCTTTCTGTCAC
TCTAAGTTTGGTTACAATTGGGGCGACTGATGGAGGGTTCTGTTCTGCTC
CGTCAATCTTGGACAGAGAGACAAGCTCAAAGCCTATGTATTGGAAAGTC
ACAAACCCAACACTATCTCCTTCTCATCTACAAGAAAATGCCAGATCAGC
CCTTCCCCCTCATGATGTAGAGAGGTTCATATTTGTTGTTCAGGGTTCTG
CGATGCTCACTAATGCATCAGGTGTTAGCAGCAAACTGATGGTGGATTCG
TATACTTATCTACCTCCTAATTTTGCACATTCTCTGAGGGCTGAAGGATC
AGCTACTCTTGTTGTATTTGAGCGCAGGTATGCCTCTCTTGAAAATCATA
TAACTGAGCAGATTGTTGGTTCAACAGACAAGCAGCCACTGCTTGAAACT
CCCGGAGAGGTTTTTCAGCTTAGAAAGCTTCTTCCTCAAGCAGTTCCTTT
TGACTTCAATATCCACATCATGGATTTTCAACCTGGAGAGTTCCTTAATG
TGAAGGAGGTCCACTATAATCAGCATGGTTTATTGCTTTTAGAGGGACAG
GGTATCTATCGTTTGGGTGATAGCTGGTACCCAGTTCAAGCTGGTGATGT
GCTTTGGATGGCACCATTTGTGCCACAATGGTATGCTGCACTTGGTAAAA
CCCGGACTCGTTATTTGCTGTACAAAGATGTAAACAGGAATCCATTGTAA
TCACATGCAGCTGGAAATGCGCCACCCAGGAATCCAGTGACATATGGTCC
TGATGCAATCCATTTATGTGAAACACAGAATGAGCACACATTGATATGGT
GCAAATGGCAAGATCCATCTATGTGAAGCGATATGTCCGTCTGTACGGCC
TGAAAACATGATATCAAATATGTATATGGTATCANTCTGAAACTGTGTAT
GCCATCAAGAAATCAATATTTAATGCCTCATCAAGGGGTCTAAATTCATT
GAAAAGCAGAATTGTAAGTGCTAATGCTATGCTTAATGGTTATACTTTTA
CACTCTTTTAGGGGCCTGACAGGCTTG
back to top