DC900124

Overview
NameDC900124
Unique NameDC900124
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length751
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig859 contig Csv1_Contig859:304..1054. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900124 vs. ExPASy Swiss-Prot
Match: C3H41_ARATH (Zinc finger CCCH domain-containing protein 41 OS=Arabidopsis thaliana GN=At3g27700 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.551e-29
Identity = 88/251 (35.06%), Postives = 120/251 (47.81%), Query Frame = 1
Query:    1 VMGHRFIKLWWANRDSIPDDGISSGVNVSVTSHGMTAASVPAHTSVANKVXDNHLQSTTLKGGNIVPAADVSLPAPDHPTVITNSXXXXXXXXXXXDNXXXXXXXXXXXXXXXXXXXNDFRRQLDKLEKQAG-GKSDVVSEKAAKRLKVGIAADVAKATARSSDSTAAVASPRAEMMADKNKLVDIVLSPSQKVNTAMVLQESTSFKQQIRPLAPAGPPFLMNRYKLDNRPTAFRIMPPLPXGFADVAVLK 750
            VMG+RFIKLWWANRDSIPD+G+S+G   S+    MTA+       +A     NH+ S           A  S   P    V T+            D                    N++R++L  LEKQ    K +   E  AKR+K+  A          SDS AA+ASP+ E   DK   +   LS + K++T     +S +FKQ+      +    ++NRYKLDNR T  +++PPLP G ADVAV+K
Sbjct:  497 VMGNRFIKLWWANRDSIPDNGLSTGSGASMKGRSMTASGAQNQFPIAAASKSNHVSSIAKVPTFQTGGAPSSSEQPKPVVVTTSGPKVTPLQQKKADTLERLKETLRKKQEMLEQKRNEYRKKLATLEKQGTVVKREEADEPDAKRVKLDTA----------SDSGAAIASPKTESSTDKKVPILKPLS-TAKLSTETPSPDSKNFKQRPYSFTTSLNAPMVNRYKLDNRTTTIKVVPPLPTGLADVAVVK 736          
BLAST of DC900124 vs. ExPASy Swiss-Prot
Match: C3H27_ORYSJ (Zinc finger CCCH domain-containing protein 27 OS=Oryza sativa subsp. japonica GN=Os04g0394300 PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 4.269e-19
Identity = 86/253 (33.99%), Postives = 122/253 (48.22%), Query Frame = 1
Query:    1 VMGHRFIKLWWANRDSIPDDGISSGVNVSVTSHGMTAA---SVPAHTSVANKVXDNHLQSTTLKGGNIVPAADVSLPAPDHPTVITNSXXXXXXXXXXXDNXXXXXXXXXXXXXXXXXXXNDFRRQLDKLEKQAGGKSDVVSEKAAKRLKVGIAADVAKATARSSDSTAAVASPRAEMMADKNKLVDIVLSPSQKVNTAMVLQESTSFKQQIRPLAPAGPPFLMNRYKLDNRPTAFRIMPPLPXGFADVAVLK 750
            VMG+RFIKLWWANRD IPD+    G   + +SH M+AA   SVP  +S +N+  +N LQS T +  +   +A+ S P   H  +  NS           ++                   ++FRRQL+KL KQ G  +     +A    K   + DV + T   S +T     PR      +N+    + S S K +     + + + KQ    L P+      NR+KLDNR T+FRI+PPLP   AD +VLK
Sbjct:  518 VMGNRFIKLWWANRDRIPDE--VEGRIPAKSSH-MSAALANSVPQPSS-SNRGKEN-LQSATPRASS-GSSAEASGPGTGHKMLPANSVKSLPPDTKRQESLELLEELRKKQEILAQKR-DEFRRQLEKLAKQKGLANSAKQAEAGG--KEVASNDVHRVTDSKSMNTGT-EGPRDAAGTLQNRTSGELASSSHKSSATSAQKPAVATKQTSPLLVPS-----QNRFKLDNRTTSFRILPPLPPEIADESVLK 755          
The following BLAST results are available for this feature:
BLAST of DC900124 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
C3H41_ARATH4.551e-2935.06Zinc finger CCCH domain-containing protein 41 OS=A... [more]
C3H27_ORYSJ4.269e-1933.99Zinc finger CCCH domain-containing protein 27 OS=O... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900124 VSS Citrus sinensis cDNA clone VS27V41 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900124 ID=DC900124|Name=DC900124|organism=Citrus sinensis|type=EST|length=751bp
GTTATGGGCCATCGATTTATCAAGCTTTGGTGGGCTAATCGTGACAGCAT
ACCAGATGATGGAATAAGCAGTGGCGTTAATGTATCCGTGACTTCTCATG
GTATGACAGCTGCTTCAGTTCCAGCGCATACCTCTGTTGCTAACAAAGTG
ANNGACAATCATCTTCAATCCACCACTCTGAAGGGAGGAAATATTGTTCC
TGCTGCTGATGTTTCTCTGCCCGCTCCTGATCACCCTACTGTTATTACAA
ATAGTCCCAAACCTCCACCTCCATTGCAAAAGAAGCTGGACAATCTTGAG
CAGTTGAAGGAGGAACTCCGTAAAAAGCAGGAATTGTTGGACCAGAAGCG
GAATGACTTCCGCCGTCAACTGGACAAATTAGAGAAACAGGCTGGAGGCA
AGAGTGATGTGGTGTCTGAGAAAGCTGCTAAAAGACTTAAAGTGGGAATA
GCAGCTGATGTAGCAAAAGCGACAGCAAGGTCCTCTGATTCTACTGCAGC
TGTGGCATCACCACGTGCTGAGATGATGGCAGACAAGAACAAACTAGTGG
ATATTGTTTTGTCTCCTAGTCAGAAAGTAAACACAGCCATGGTGCTGCAG
GAATCTACAAGCTTCAAGCAGCAGATTCGTCCATTAGCACCTGCAGGGCC
TCCATTTTTGATGAATAGATACAAATTGGATAACCGACCTACAGCATTTA
GAATTATGCCACCTTTACCTGNGGGTTTTGCAGATGTTGCTGTCTTGAAG
A
back to top