DC900123

Overview
NameDC900123
Unique NameDC900123
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length555
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1492 contig Csv1_Contig1492:90..644. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_WHEAT (Histone H3.2 OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_TOBAC (Histone H3.2 OS=Nicotiana tabacum GN=B34 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_PETCR (Histone H3.2 OS=Petroselinum crispum GN=H3-7 PE=3 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_PEA (Histone H3.2 OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_ORYSJ (Histone H3.2 OS=Oryza sativa subsp. japonica GN=Os01g0866200 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_ORYSI (Histone H3.2 OS=Oryza sativa subsp. indica GN=OsI_019426 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_ONOVI (Histone H3.2 OS=Onobrychis viciifolia PE=2 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_MEDSA (Histone H3.2 OS=Medicago sativa GN=H3-1.1 PE=1 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_MAIZE (Histone H3.2 OS=Zea mays GN=H3C2 PE=1 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of DC900123 vs. ExPASy Swiss-Prot
Match: H32_EUPES (Histone H3.2 OS=Euphorbia esula GN=H3 PE=2 SV=3)

HSP 1 Score: 221.09 bits (562), Expect = 2.893e-57
Identity = 115/132 (87.12%), Postives = 115/132 (87.12%), Query Frame = 1
Query:    1 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFXXXXXXXXXXXXXXXXXGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 396
            KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRF                 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    5 KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
The following BLAST results are available for this feature:
BLAST of DC900123 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 211
Match NameE-valueIdentityDescription
H32_WHEAT2.893e-5787.12Histone H3.2 OS=Triticum aestivum PE=1 SV=2[more]
H32_TOBAC2.893e-5787.12Histone H3.2 OS=Nicotiana tabacum GN=B34 PE=1 SV=1[more]
H32_PETCR2.893e-5787.12Histone H3.2 OS=Petroselinum crispum GN=H3-7 PE=3 ... [more]
H32_PEA2.893e-5787.12Histone H3.2 OS=Pisum sativum PE=1 SV=2[more]
H32_ORYSJ2.893e-5787.12Histone H3.2 OS=Oryza sativa subsp. japonica GN=Os... [more]
H32_ORYSI2.893e-5787.12Histone H3.2 OS=Oryza sativa subsp. indica GN=OsI_... [more]
H32_ONOVI2.893e-5787.12Histone H3.2 OS=Onobrychis viciifolia PE=2 SV=2[more]
H32_MEDSA2.893e-5787.12Histone H3.2 OS=Medicago sativa GN=H3-1.1 PE=1 SV=... [more]
H32_MAIZE2.893e-5787.12Histone H3.2 OS=Zea mays GN=H3C2 PE=1 SV=2[more]
H32_EUPES2.893e-5787.12Histone H3.2 OS=Euphorbia esula GN=H3 PE=2 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900123 VSS Citrus sinensis cDNA clone VS27V40 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900123 ID=DC900123|Name=DC900123|organism=Citrus sinensis|type=EST|length=555bp
AAGCAAACCGCTCGCAAGTCCACCGGAGGCAAGGCCCCAAGAAAGCAACT
GGCGACCAAGGCGGCAAGGAAATCCGCACCGGCAACCGGAGGAGTGAAGA
AGCCTCACAGGTTCCGTCCAGGAACTGTCGCACTCCGTGAAATCAGGAAG
TACCAGAAGAGCACTGAGCTTCTTATTAGGAAGCTTCCGTTCCAGAGATT
GGTGAGGGAAATCGCTCAGGATTTCAAGACGGATCTGAGGTTCCAGAGCA
GCGCTGTTGCTGCACTTCAGGAGGCTGCTGAGGCTTATCTTGTTGGGCTG
TTCGAGGACACCAACCTCTGCGCTATTCATGCTAAGAGGGTCACTATTAT
GCCCAAGGACATTCAGCTTGCTAGGCGGATCAGGGGTGAAAGGGCTTAGG
AACTTTCTGATTTAATGTATTTTGTTCCTCTTACTTCGATGTTAGTCTTT
TGGTCAATATTTGGGGTTTAGATTTATGTTTGGATGTCTATCCGATGGAT
TAGATCGGGTCTAGTATGTATCTAAGGTGTTTGTTAAAATGTTTTCGAGG
GTTTT
back to top