DC900120

Overview
NameDC900120
Unique NameDC900120
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length653
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13557 contig Csv1_Contig13557:48..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO_RICCO (Enolase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 8.258e-103
Identity = 183/205 (89.27%), Postives = 194/205 (94.63%), Query Frame = 1
Query:   37 MAITITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            MAITI +V+ARQIFDSRGNPTVE D+  SDGH+AR AVPSGASTGIYEALELRDGGSDYLGKGVSKAV NVN+IIGPAL GKDPTEQTA+DN+MVQ+LDGTVNEWGWCKQKLGANAILAVSLA+CKAGAHVK IPLYKHIA L+GNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMG EVYHHLK+ IKKK
Sbjct:    1 MAITIVSVRARQIFDSRGNPTVEADIKLSDGHLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVENVNSIIGPALIGKDPTEQTALDNFMVQELDGTVNEWGWCKQKLGANAILAVSLALCKAGAHVKGIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYHHLKSVIKKK 205          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO1_HEVBR (Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 3.470e-101
Identity = 182/205 (88.78%), Postives = 191/205 (93.17%), Query Frame = 1
Query:   37 MAITITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            MAITI +V+ARQIFDSRGNPTVE DV  SDG++AR AVPSGASTGIYEALELRDGGSDYLGKGVSKAV NVN IIGPAL GKDPT+Q  IDN+MVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVK IPLY+HIA L+GNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMG EVYHHLK+ IKKK
Sbjct:    1 MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKGIPLYEHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYHHLKSVIKKK 205          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO2_HEVBR (Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 5.918e-101
Identity = 181/205 (88.29%), Postives = 190/205 (92.68%), Query Frame = 1
Query:   37 MAITITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            MAITI +V+ARQIFDSRGNPTVE DV  SDG++AR AVP GASTGIYEALELRDGGSDYLGKGVSKAV NVN IIGPAL GKDPT+Q  IDN+MVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVK IPLYKH+A L+GNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMG EVYHHLK+ IKKK
Sbjct:    1 MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYLGKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYHHLKSVIKKK 205          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO1_MAIZE (Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 2.749e-98
Identity = 181/205 (88.29%), Postives = 188/205 (91.71%), Query Frame = 1
Query:   37 MAITITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            MA+TIT VKARQIFDSRGNPTVEVDV  SDG  AR AVPSGASTGIYEALELRDGGSDYLGKGV KAVSNVN IIGPA+ GKDPTEQ  IDN+MVQQLDGT NEWGWCKQKLGANAILAVSLAVCKAGA VKKIPLY+HIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASSFKEAMKMGVEVYH+LK+ IKKK
Sbjct:    1 MAVTITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKGVLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFKEAMKMGVEVYHNLKSIIKKK 205          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO2_MAIZE (Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 3.970e-97
Identity = 176/205 (85.85%), Postives = 188/205 (91.71%), Query Frame = 1
Query:   37 MAITITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            MA TI +VKARQIFDSRGNPTVEVDV  SDG  AR AVPSGASTG+YEALELRDGGS YLGKGVSKAV+NVN++IGPAL GKDPT QT IDN+MVQQLDGT NEWGWCKQKLGANAILAVSLAVCKAGA +K+IPLY+HIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+SFKEAMKMGVEVYHHLK+ IKKK
Sbjct:    1 MAATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGSYYLGKGVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSLAVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAASFKEAMKMGVEVYHHLKSVIKKK 205          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO_MESCR (Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.970e-96
Identity = 172/203 (84.73%), Postives = 185/203 (91.13%), Query Frame = 1
Query:   43 ITITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            +TI  VKARQI+DSRGNPTVE D+   DG  AR AVPSGASTG+YEALELRDGG DY+GKGV KAV NVN IIGPAL GKDPT+QTAIDN+MVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGA VKKIPLY+HIAE++GNKN+VLPVPAFNVINGGSHAGNKLAMQEFMILP GASSFKEAMKMG EVYH+LK+ IKKK
Sbjct:    2 VTIKCVKARQIYDSRGNPTVEADIHLDDGTYARAAVPSGASTGVYEALELRDGGKDYMGKGVYKAVKNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAQVKKIPLYQHIAEIAGNKNMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFKEAMKMGSEVYHNLKSVIKKK 204          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO_ORYSJ (Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2)

HSP 1 Score: 350.517 bits (898), Expect = 4.389e-96
Identity = 173/205 (84.39%), Postives = 186/205 (90.73%), Query Frame = 1
Query:   37 MAITITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            MA TI +VKARQIFDSRGNPTVEVDV  SDG  AR AVPSGASTG+YEALELRDGGSDYLGKGVSKAV NVN++I PAL GKDPT Q  +DN+MVQQLDGT NEWGWCKQKLGANAILAVSLA+CKAGA +KKIPLY+HIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+SFKEAMKMGVEVYH+LK+ IKKK
Sbjct:    1 MAATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGKGVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSLAICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAASFKEAMKMGVEVYHNLKSVIKKK 205          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO_SOLLC (Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 5.732e-96
Identity = 172/202 (85.15%), Postives = 187/202 (92.57%), Query Frame = 1
Query:   46 TITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            TI ++KARQIFDSRGNPTVEVDV  S+G  AR AVPSGASTGIYEALELRDGGSDYLGKGVSKAV+NVN+IIGPAL GKDPT+QT +DN+MV QLDGT NEWGWCK+KLGANAILAVSLAVCKAGA V+ +PLYKHIA+L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA++FKEAMKMG EVYHHLKA IKKK
Sbjct:    3 TIKSIKARQIFDSRGNPTVEVDVHISNGVFARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTGLDNFMVHQLDGTQNEWGWCKEKLGANAILAVSLAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFKEAMKMGCEVYHHLKAVIKKK 204          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO_ALNGL (Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.277e-95
Identity = 177/202 (87.62%), Postives = 186/202 (92.08%), Query Frame = 1
Query:   49 ITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAID-NYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            IT +KARQIFDSRGNPTVE +VTT++G V+R AVPSGASTG+YEALELRDGGSDYLGKGV KAV NVN IIGPAL GKD TEQTAID ++M QQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGA VKKIPLYKHIA L+GN  LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKA IKKK
Sbjct:    4 ITHIKARQIFDSRGNPTVEAEVTTANGVVSRAAVPSGASTGVYEALELRDGGSDYLGKGVLKAVDNVNKIIGPALIGKDATEQTAIDIDFMFQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAVIKKK 205          
BLAST of DC900120 vs. ExPASy Swiss-Prot
Match: ENO_ARATH (Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 4.853e-95
Identity = 174/202 (86.14%), Postives = 183/202 (90.59%), Query Frame = 1
Query:   46 TITAVKARQIFDSRGNPTVEVDVTTSDGHVARXAVPSGASTGIYEALELRDGGSDYLGKGVSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAGIKKK 651
            TIT VKARQIFDSRGNPTVEVD+ TS+G     AVPSGASTGIYEALELRDGGSDYLGKGVSKAV NVN IIGPAL GKDPT+QTAIDN+MV +LDGT NEWGWCKQKLGANAILAVSLAVCKAGA V  IPLYKHIA L+GN  +VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA+SFKEAMKMGVEVYHHLK+ IKKK
Sbjct:    3 TITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVSLAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAASFKEAMKMGVEVYHHLKSVIKKK 204          
The following BLAST results are available for this feature:
BLAST of DC900120 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
ENO_RICCO8.258e-10389.27Enolase OS=Ricinus communis PE=2 SV=1[more]
ENO1_HEVBR3.470e-10188.78Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1[more]
ENO2_HEVBR5.918e-10188.29Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1[more]
ENO1_MAIZE2.749e-9888.29Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1[more]
ENO2_MAIZE3.970e-9785.85Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1[more]
ENO_MESCR1.970e-9684.73Enolase OS=Mesembryanthemum crystallinum GN=PGH1 P... [more]
ENO_ORYSJ4.389e-9684.39Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE... [more]
ENO_SOLLC5.732e-9685.15Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1[more]
ENO_ALNGL1.277e-9587.62Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1[more]
ENO_ARATH4.853e-9586.14Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900120 VSS Citrus sinensis cDNA clone VS27V36 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900120 ID=DC900120|Name=DC900120|organism=Citrus sinensis|type=EST|length=653bp
TTCTAGATCTTTCTTCGCTTTTCCAGCTTTCAGAAAATGGCAATAACCAT
CACTGCCGTCAAAGCCAGGCAGATCTTTGACAGCCGTGGAAATCCAACGG
TGGAGGTCGACGTGACAACATCAGATGGCCACGTGGCTAGANCTGCTGTT
CCAAGCGGTGCATCCACCGGAATTTATGAGGCGCTTGAACTAAGAGACGG
AGGCTCTGATTACCTAGGCAAGGGTGTATCGAAGGCTGTTAGCAATGTCA
ACGCCATCATTGGCCCTGCACTCGCTGGCAAGGACCCAACTGAGCAGACT
GCTATTGACAACTATATGGTACAACAACTTGATGGAACTGTAAATGAGTG
GGGTTGGTGCAAACAGAAGCTTGGAGCAAACGCCATTTTGGCTGTCTCCC
TAGCTGTCTGCAAGGCTGGTGCACATGTCAAGAAGATTCCTCTTTACAAG
CATATTGCCGAACTCTCTGGTAACAAGAATTTGGTGTTGCCAGTGCCAGC
ATTCAATGTCATTAATGGTGGATCACATGCTGGAAACAAACTTGCTATGC
AGGAGTTTATGATTCTTCCTGTAGGAGCTTCCTCTTTCAAAGAAGCCATG
AAGATGGGTGTAGAAGTATATCACCATCTGAAGGCTGGGATTAAAAAGAA
ATA
back to top