DC900119

Overview
NameDC900119
Unique NameDC900119
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:1069..1764. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.350e-61
Identity = 113/118 (95.76%), Postives = 117/118 (99.15%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 355
            PT VDRSGAYIVRQAAKSIVA+GLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGMM+INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ
Sbjct:  275 PTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMSINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 392          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK_MEDTR (S-adenosylmethionine synthetase OS=Medicago truncatula GN=METK PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.303e-61
Identity = 112/119 (94.12%), Postives = 117/119 (98.32%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAY+VRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPD+EIL+IVKE+FDFRPGM+TINLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  276 PTKVDRSGAYVVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDREILQIVKENFDFRPGMITINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 394          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.303e-61
Identity = 112/119 (94.12%), Postives = 117/119 (98.32%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVP+PLSVFVDSYGTGKIPDKEILKIVKE+FDFRPGM+TINLDLKRGGN RFLKTAAYGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  275 PTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPDPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNDRFLKTAAYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.130e-61
Identity = 115/119 (96.64%), Postives = 117/119 (98.32%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGMMTINLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  275 PTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGGN-RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 392          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK2_VITVI (S-adenosylmethionine synthetase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 6.701e-61
Identity = 112/119 (94.12%), Postives = 117/119 (98.32%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPD+EILKIVKE+FDFRPGM++INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK QA
Sbjct:  275 PTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKTQA 393          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 8.751e-61
Identity = 110/119 (92.44%), Postives = 116/119 (97.48%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAYIVRQAAKSIVANGLARRC+VQVSYAIGVPEPLSVFVDSYGTG+IPDKEIL IVKE+FDFRPGM+TINLDLKRGGNGRFLKTA YGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  275 PTKVDRSGAYIVRQAAKSIVANGLARRCLVQVSYAIGVPEPLSVFVDSYGTGQIPDKEILNIVKENFDFRPGMITINLDLKRGGNGRFLKTAGYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK_BRARP (S-adenosylmethionine synthetase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.143e-60
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAYIVRQAAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  275 PTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK5_BRAJU (S-adenosylmethionine synthetase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.143e-60
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAYIVRQAAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  275 PTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK3_BRAJU (S-adenosylmethionine synthetase 3 OS=Brassica juncea GN=MSAMS3 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.143e-60
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 358
            PT VDRSGAYIVRQAAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  275 PTKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of DC900119 vs. ExPASy Swiss-Prot
Match: METK5_VITVI (S-adenosylmethionine synthetase 5 OS=Vitis vinifera GN=METK5 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.493e-60
Identity = 112/116 (96.55%), Postives = 114/116 (98.28%), Query Frame = 2
Query:    2 PTNVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 349
            PT VDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKE+FDFRPGM+ INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK
Sbjct:  275 PTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390          
The following BLAST results are available for this feature:
BLAST of DC900119 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK1_SOLTU1.350e-6195.76S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK_MEDTR2.303e-6194.12S-adenosylmethionine synthetase OS=Medicago trunca... [more]
METK2_ELAUM2.303e-6194.12S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK1_POPTR5.130e-6196.64S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK2_VITVI6.701e-6194.12S-adenosylmethionine synthetase 2 OS=Vitis vinifer... [more]
METK1_ELAUM8.751e-6192.44S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK_BRARP1.143e-6093.28S-adenosylmethionine synthetase OS=Brassica rapa s... [more]
METK5_BRAJU1.143e-6093.28S-adenosylmethionine synthetase 5 OS=Brassica junc... [more]
METK3_BRAJU1.143e-6093.28S-adenosylmethionine synthetase 3 OS=Brassica junc... [more]
METK5_VITVI1.493e-6096.55S-adenosylmethionine synthetase 5 OS=Vitis vinifer... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900119 VSS Citrus sinensis cDNA clone VS27V34 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900119 ID=DC900119|Name=DC900119|organism=Citrus sinensis|type=EST|length=696bp
CCCTACTAACGTGGATAGGAGTGGTGCATACATTGTTAGGCAGGCTGCTA
AGAGCATTGTTGCAAACGGGCTTGCTCGCAGGTGCATTGTCCAAGTCTCC
TATGCCATTGGTGTGCCTGAGCCATTGTCTGTTTTTGTGGACTCATATGG
AACCGGCAAGATTCCTGACAAGGAGATCCTCAAAATTGTGAAGGAAAGCT
TTGATTTCAGGCCAGGAATGATGACCATCAATTTGGATCTCAAAAGGGGC
GGTAATGGCAGGTTCTTGAAGACTGCTGCCTATGGACACTTTGGCAGGGA
TGACCCAGACTTCACTTGGGAAGTTGTGAAGCCCCTCAAGTGGGAAAAGC
CTCAAGCTTAAATTTGAGTTGAAAAGTGAAAACTATCCCTGCTGTTCAAG
TTTGCTTCTATTGGTAGTGGATGAATAATTTGAATATTATCTTGCTGCTG
CTTTGTAATACTAAGCAAATCTCCTGTGTTCAGAACTCATACATGTTCCC
CATTCAATTCCTTTCTTTTTCTTCTTTCCCCACTTCTTTTTTGGTTTTGG
TTTAATGTACCATGTCACCACTGTTGTGTAGTGATATCGATTGAGAATTT
TGCTCAACTGGTGCCTGGAATTAGTAAAATTCTTCCTTTTGCTTACGACT
ATTTTTGGAATGTAGAATGAANGCAGCAGCGAGTTGTATTAATTTG
back to top