DC900117

Overview
NameDC900117
Unique NameDC900117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8536 contig Csv1_Contig8536:33..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_ORYSJ (60S ribosomal protein L3 OS=Oryza sativa subsp. japonica GN=RPL3 PE=2 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 7.487e-77
Identity = 134/150 (89.33%), Postives = 144/150 (96.00%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLKA 452
            RLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTEMNKK+YK+GK+ QESH+A TEFDRTEKDITPMGGFPHYGVV  DYL+IKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTT EK +++G+LKA
Sbjct:  240 RLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACTEFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQRFFGKLKA 389          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL32_ARATH (60S ribosomal protein L3-2 OS=Arabidopsis thaliana GN=ARP2 PE=2 SV=4)

HSP 1 Score: 278.87 bits (712), Expect = 1.561e-74
Identity = 128/147 (87.07%), Postives = 141/147 (95.92%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGR 443
            RLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTEMNKK+Y++GK  QE+HSAMTE+DRTEKDITPMGGFPHYG+V EDYL+IKGCCVGPKKRVVTLRQ+LLKQTSRLA+EEIKLKFID +S  GHGRFQT+QEKAK+YGR
Sbjct:  240 RLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVGKVGQETHSAMTEYDRTEKDITPMGGFPHYGIVKEDYLMIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKLKFIDAASNGGHGRFQTSQEKAKFYGR 386          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL31_ARATH (60S ribosomal protein L3-1 OS=Arabidopsis thaliana GN=ARP1 PE=2 SV=5)

HSP 1 Score: 270.396 bits (690), Expect = 5.552e-72
Identity = 124/148 (83.78%), Postives = 139/148 (93.92%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRL 446
            RLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKKIY+LGK   E+H+AMTE+DRTEKD+TPMGGFPHYG+V +DYL+IKGCCVGPKKRVVTLRQSLL QTSRLALEEIKLKFIDT+S FGHGRFQT+ EK ++Y R+
Sbjct:  240 RLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_DROME (60S ribosomal protein L3 OS=Drosophila melanogaster GN=RpL3 PE=1 SV=3)

HSP 1 Score: 224.172 bits (570), Expect = 4.563e-58
Identity = 105/155 (67.74%), Postives = 125/155 (80.65%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQES------HSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTH+GLRKVACIGAWHP+RVS TVARAGQ GYHHRTE+NKKIY++G            ++A TE+D T+K ITPMGGFPHYG VN D+++IKGCC+G KKR++TLR+SLLK T R ALE+IKLKFIDTSSK GHGRFQT  +K  + G LK
Sbjct:  239 KLPRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIKNNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSALEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLK 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_TOXCA (60S ribosomal protein L3 OS=Toxocara canis GN=RPL3 PE=2 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 2.265e-57
Identity = 102/152 (67.11%), Postives = 126/152 (82.89%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA---SQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTH+GLRKVACIGAWHP+RV FTVARAGQ GYHHRTE+NKKIY+LGK+    +   +  T++D TEK + PMGGFPHYG+VN+D+++I+GCCVG KKR +TLR+SL+ QT R A E+I LK+IDTSSKFGHGRFQT  EK  + G+LK
Sbjct:  239 KLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTEVNKKIYRLGKSCLTEEGKKNGGTDYDITEKSVNPMGGFPHYGLVNQDFVMIRGCCVGSKKRPITLRKSLIVQTKRFAHEKINLKWIDTSSKFGHGRFQTHAEKRAFMGKLK 390          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_CAEEL (60S ribosomal protein L3 OS=Caenorhabditis elegans GN=rpl-3 PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.623e-55
Identity = 99/155 (63.87%), Postives = 129/155 (83.23%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKAS---QESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLKA*F 458
            +LPRKTH+GLRKVACIGAWHP+RV+FTVARAGQ G+HHRT +N KIY++GK++   +  ++  TEFD T+K ITPMGGFP YG+VN+DY++++G  +GPKKR++TLR+SL+ QT R+A E+I LK+IDTSSK GHGRFQTT EK  + G+LK  F
Sbjct:  239 KLPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSALTEEGKNNGSTEFDLTQKTITPMGGFPRYGIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRDF 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_MOUSE (60S ribosomal protein L3 OS=Mus musculus GN=Rpl3 PE=2 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 6.167e-55
Identity = 102/155 (65.81%), Postives = 124/155 (80.00%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA------SQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPARV+FTVARAGQ GYHHRTE+NKKIYK+G+           ++A T++D ++K I P+GGF HYG V  D++++KGC VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK  + G LK
Sbjct:  239 KLPRKTHRGLRKVACIGAWHPARVAFTVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_CAEBR (60S ribosomal protein L3 OS=Caenorhabditis briggsae GN=rpl-3 PE=3 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 1.374e-54
Identity = 98/155 (63.23%), Postives = 128/155 (82.58%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKAS---QESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLKA*F 458
            +LPRKTH+GLRKVACIGAWHP+RV+FTVARAGQ G+HHRT +N KIY++GK++   +  ++  TEFD T+K I PMGGFP YG+VN+DY++++G  +GPKKR++TLR+SL+ QT R+A E+I LK+IDTSSK GHGRFQTT EK  + G+LK  F
Sbjct:  239 KLPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSALTEEGKNNGSTEFDLTQKTINPMGGFPRYGLVNQDYVMLRGAILGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRDF 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_RAT (60S ribosomal protein L3 OS=Rattus norvegicus GN=Rpl3 PE=1 SV=3)

HSP 1 Score: 212.231 bits (539), Expect = 1.794e-54
Identity = 101/155 (65.16%), Postives = 124/155 (80.00%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA------SQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G+           ++A T++D ++K I P+GGF HYG V  D++++KGC VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK  + G LK
Sbjct:  239 KLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393          
BLAST of DC900117 vs. ExPASy Swiss-Prot
Match: RL3_BOVIN (60S ribosomal protein L3 OS=Bos taurus GN=RPL3 PE=2 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 1.794e-54
Identity = 101/155 (65.16%), Postives = 124/155 (80.00%), Query Frame = 3
Query:    3 RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA------SQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLK 449
            +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G+           ++A T++D ++K I P+GGF HYG V  D++++KGC VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK  + G LK
Sbjct:  239 KLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK 393          
The following BLAST results are available for this feature:
BLAST of DC900117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
RL3_ORYSJ7.487e-7789.3360S ribosomal protein L3 OS=Oryza sativa subsp. ja... [more]
RL32_ARATH1.561e-7487.0760S ribosomal protein L3-2 OS=Arabidopsis thaliana... [more]
RL31_ARATH5.552e-7283.7860S ribosomal protein L3-1 OS=Arabidopsis thaliana... [more]
RL3_DROME4.563e-5867.7460S ribosomal protein L3 OS=Drosophila melanogaste... [more]
RL3_TOXCA2.265e-5767.1160S ribosomal protein L3 OS=Toxocara canis GN=RPL3... [more]
RL3_CAEEL1.623e-5563.8760S ribosomal protein L3 OS=Caenorhabditis elegans... [more]
RL3_MOUSE6.167e-5565.8160S ribosomal protein L3 OS=Mus musculus GN=Rpl3 P... [more]
RL3_CAEBR1.374e-5463.2360S ribosomal protein L3 OS=Caenorhabditis briggsa... [more]
RL3_RAT1.794e-5465.1660S ribosomal protein L3 OS=Rattus norvegicus GN=R... [more]
RL3_BOVIN1.794e-5465.1660S ribosomal protein L3 OS=Bos taurus GN=RPL3 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900117 VSS Citrus sinensis cDNA clone VS27V32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900117 ID=DC900117|Name=DC900117|organism=Citrus sinensis|type=EST|length=641bp
CTCGTCTCCCTCGTAAGACTCACCGTGGTCTACGCAAGGTTGCTTGTATT
GGTGCCTGGCATCCGGCTAGGGTCTCCTTTACCGTTGCTAGAGCTGGGCA
GAACGGCTACCATCACCGTACAGAGATGAACAAGAAAATTTACAAGCTTG
GGAAGGCCAGCCAGGAGTCTCATTCTGCCATGACTGAATTTGACAGGACG
GAGAAGGATATCACCCCAATGGGAGGCTTCCCCCACTATGGTGTAGTCAA
TGAAGATTACCTGCTGATCAAGGGCTGCTGTGTTGGACCTAAGAAGCGTG
TTGTGACGTTAAGGCAGTCCCTACTGAAGCAGACGTCTAGGCTTGCATTG
GAGGAGATTAAGCTCAAGTTCATTGACACATCCTCCAAGTTCGGCCATGG
TCGGTTCCAGACAACGCAGGAGAAGGCCAAGTACTATGGAAGGCTCAAGG
CTTGATTTTGGCCAAGTTGAAGAAGAGATTGCCTTTGGTTTCAGGGTAGT
TTTGAACATCTAAGATTTTTGGTCATTCTAGTCTCTATTTTGAATTAATA
TGGCTATGGCTACACTGGCAGTTCTTGGAAACTTCATTTGTGCATGGTTT
GTTTTTTGCGCGTTAATACATCTTACGGTATTTTTGGGCTT
back to top