DC900113

Overview
NameDC900113
Unique NameDC900113
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length960
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900113_ssr45 microsatellite DC900113_ssr45:45..71. BLAST: Citrus ESTs to Prunus persica proteins V1
DC900113_ssr67 microsatellite DC900113_ssr67:67..78. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9730 contig Csv1_Contig9730:28..993. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP28_ARATH (Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 1.700e-141
Identity = 246/268 (91.79%), Postives = 255/268 (95.15%), Query Frame = 3
Query:  123 HGKDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 926
            HGKDYVDP PAPL+DMAELKLWSFYRA+IAEF+ATLLFLYV+VATVIGHK Q+  CGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL RAVAYMVAQCLGAICGVGLVKAFM   Y  LGGGANTVA GY+ G+ALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL SFRSNP+N
Sbjct:   11 HGKDYVDPPPAPLLDMAELKLWSFYRAIIAEFIATLLFLYVTVATVIGHKNQTGPCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFRSNPTN 278          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP27_ARATH (Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2)

HSP 1 Score: 500.36 bits (1287), Expect = 6.460e-141
Identity = 241/269 (89.59%), Postives = 256/269 (95.17%), Query Frame = 3
Query:  120 HHGKDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 926
            HHGKDYVDP PAPL+DM ELK WSFYRALIAEF+ATLLFLYV+VATVIGHKKQ+  C GVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YM+AQCLGAICGVG VKAFMK  YN+LGGGANTVA GY+KG+ALGAEIIGTFVLVYTVFSATDPKRSARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDD WIFWVGPF+GALAAAAYHQYILRA+AIKALGSFRSN +N
Sbjct:   12 HHGKDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNATN 280          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP1_ATRCA (Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 1.945e-137
Identity = 232/270 (85.93%), Postives = 250/270 (92.59%), Query Frame = 3
Query:  117 HHHGKDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 926
            H HGKDYVDP PAP  DM ELKLWSF+RA IAEF+ATLLFLY++VATVIG+KK++D C  VGLLGIAW+FGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YM+AQC GAICGVGLVKAFMK  YN  GGGAN+VA GYNKG+A GAE+IGTFVLVYTVFSATDPKRSARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  + WDDHWIFWVGPFVGALAAAAYHQY+LRAAAIKALGSFRSNP+N
Sbjct:   13 HQHGKDYVDPPPAPFFDMGELKLWSFWRAAIAEFIATLLFLYITVATVIGYKKETDPCASVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFGAELIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKKRVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKALGSFRSNPTN 282          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP26_ORYSJ (Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2)

HSP 1 Score: 472.626 bits (1215), Expect = 1.443e-132
Identity = 231/272 (84.93%), Postives = 247/272 (90.81%), Query Frame = 3
Query:  117 HHHGKDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQS--DACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 926
            H   KDY DP PAPL D+ EL+LWSFYRALIAEF+ATLLFLY++VATVIG+K QS  D CGGVG LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKVS+IRAV Y+VAQCLG I GVG+VK  MKH+YN+ GGGAN VASGY+ G+ALGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYN  KAWDDHWIFW GPF+GALAAAAYHQYILRAAAIKALGSFRSNPSN
Sbjct:   11 HVRPKDYTDPPPAPLFDVGELRLWSFYRALIAEFIATLLFLYITVATVIGYKVQSSADQCGGVGTLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVSVIRAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANMVASGYSTGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFRSNPSN 282          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP21_ORYSJ (Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 3.442e-126
Identity = 221/271 (81.55%), Postives = 241/271 (88.93%), Query Frame = 3
Query:  129 KDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDA--------CGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 917
            KDY DP PAPLID AEL  WS YRA+IAEF+ATLLFLY++VATVIG+K Q+DA        CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVKAF    +N  GGGANT+A+GY+KG+ L AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+NN+KAW +HWIFWVGPFVGA  AA YHQYILRA AIKALGSFRSN
Sbjct:   19 KDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSN 289          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 450.669 bits (1158), Expect = 5.870e-126
Identity = 221/271 (81.55%), Postives = 240/271 (88.56%), Query Frame = 3
Query:  129 KDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDA--------CGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 917
            KDY DP PAPLID AEL  WS YRA+IAEF+ATLLFLY++VATVIG+K Q+DA        CGGVG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVKAF    ++  GGGAN++ASGY++G+ LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIYN DK WDDHWIFWVGP VGA  AA YHQYILRA AIKALGSFRSN
Sbjct:   19 KDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSN 289          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.708e-125
Identity = 218/273 (79.85%), Postives = 240/273 (87.91%), Query Frame = 3
Query:  129 KDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDA----------CGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 917
            KDY DP PAPL+D AEL  WS YRA+IAEF+ATLLFLYV+VATVIG+K Q+DA          CGGVG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YMVAQCLGA+CGVGLVKAF    ++  GGGAN++ASGY++G+ LGAEI+GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+YN DK WDDHWIFWVGP +GA  AA YHQYILRA AIKALGSFRSN
Sbjct:   19 KDYTDPPPAPLVDAAELGSWSLYRAVIAEFIATLLFLYVTVATVIGYKHQTDASASGAGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIKALGSFRSN 291          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP27_MAIZE (Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 2.466e-124
Identity = 215/273 (78.75%), Postives = 234/273 (85.71%), Query Frame = 3
Query:  120 HHGKDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDA-------CGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 917
            +  KDY DP PAPLID  EL  WS YRA IAEF+ATLLFLY++V T+IG+K+QSD        C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL RKVSL+RA+ YM+AQC GAICG GL K F K  YN  GGG NTV+ GYNKG+ALGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG AVI+NNDKAWDD WI+WVGPFVGA  AA YHQYILR +AIKALGSFRSN
Sbjct:   14 YSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLTIIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSN 286          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 4.651e-123
Identity = 217/268 (80.97%), Postives = 232/268 (86.57%), Query Frame = 3
Query:  129 KDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDA------CGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRS 914
            +DY DP PAP  DM EL+ W  YRA+IAEFVATLLFLYVS+ TVIG+K Q+DA      CGGVG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVT GLFLARKVSL+R V Y+VAQCLGAICG G VKAF    Y   GGGAN +A GYNKG+ LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDD WIFWVGP +GA AAA YHQ+ILRAAAIKALGSF S
Sbjct:   16 RDYKDPPPAPFFDMEELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGS 283          
BLAST of DC900113 vs. ExPASy Swiss-Prot
Match: PIP25_MAIZE (Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 1.036e-122
Identity = 216/273 (79.12%), Postives = 237/273 (86.81%), Query Frame = 3
Query:  120 HHGKDYVDPXPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDA--------CGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRS 914
            H GKDY DP PAPL+D  EL  WS YRA+IAEFVATLLFLY++VATVIG+K Q+DA        CGGVG+LGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVK F    Y   GGGAN +++GY+KG+ L AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYNNDKAWDDHWIFWVGPF+GA  AAAYHQY+LRA+A K LGS  S
Sbjct:   11 HEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVATVIGYKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDHWIFWVGPFIGAAIAAAYHQYVLRASAAK-LGSSAS 282          
The following BLAST results are available for this feature:
BLAST of DC900113 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 219
Match NameE-valueIdentityDescription
PIP28_ARATH1.700e-14191.79Probable aquaporin PIP2-8 OS=Arabidopsis thaliana ... [more]
PIP27_ARATH6.460e-14189.59Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7... [more]
PIP1_ATRCA1.945e-13785.93Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1[more]
PIP26_ORYSJ1.443e-13284.93Probable aquaporin PIP2-6 OS=Oryza sativa subsp. j... [more]
PIP21_ORYSJ3.442e-12681.55Probable aquaporin PIP2-1 OS=Oryza sativa subsp. j... [more]
PIP21_MAIZE5.870e-12681.55Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP22_MAIZE1.708e-12579.85Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP27_MAIZE2.466e-12478.75Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1[more]
PIP24_ARATH4.651e-12380.97Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]
PIP25_MAIZE1.036e-12279.12Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900113 VSS Citrus sinensis cDNA clone VS27V27 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900113 ID=DC900113|Name=DC900113|organism=Citrus sinensis|type=EST|length=960bp
GCGTGCTTTTCTTTGATTGTTCCAAAGAGAAATCAAAATCTTGTGAAGAA
GAAGAAGAAGAAGAAGAAGAAAGAAAGATGTCAAAGGAAGTGAATGAAGA
AGGACAAACTCACCGCCATCACCATGGCAAGGACTACGTGGACCCANCAC
CAGCACCACTCATTGACATGGCTGAGCTCAAGCTCTGGTCCTTTTACAGA
GCTCTCATAGCCGAGTTCGTGGCCACTCTCCTCTTCCTCTACGTCAGTGT
TGCCACTGTCATTGGCCACAAGAAACAAAGTGATGCCTGTGGTGGTGTTG
GCCTTTTGGGTATTGCATGGGCCTTTGGTGGCATGATCTTCGTCCTTGTT
TACTGCACCGCTGGCATTTCTGGTGGTCACATTAACCCTGCTGTGACGTT
TGGGCTGTTCTTGGCAAGGAAGGTATCATTGATCAGGGCTGTGGCTTACA
TGGTGGCTCAGTGCTTGGGTGCCATTTGCGGTGTTGGTTTGGTCAAGGCC
TTCATGAAGCATGAGTACAACTCACTTGGTGGTGGTGCTAACACTGTGGC
TTCTGGCTACAACAAAGGATCAGCCTTGGGTGCTGAGATTATTGGTACCT
TCGTGCTTGTTTACACAGTCTTCTCGGCCACAGACCCCAAGAGAAGCGCT
CGTGACTCTCACGTGCCCGTTTTGGCTCCACTTCCAATTGGATTTGCTGT
GTTCATGGTTCACTTGGCCACCATCCCCATCACTGGAACGGGCATCAACC
CTGCTAGGAGCTTTGGTGCTGCTGTTATCTACAACAATGACAAGGCCTGG
GATGACCATTGGATCTTCTGGGTTGGTCCTTTCGTTGGAGCATTGGCTGC
AGCGGCATACCACCAGTACATCTTGAGGGCTGCTGCTATCAAGGCTTTGG
GATCATTCCGCAGCAACCCTTCAAACTAAGAAAGCAAATTATGATGAATA
TGAACCACCA
back to top