DC900112

Overview
NameDC900112
Unique NameDC900112
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length693
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900112 vs. ExPASy Swiss-Prot
Match: DJC13_HUMAN (DnaJ homolog subfamily C member 13 OS=Homo sapiens GN=DNAJC13 PE=1 SV=4)

HSP 1 Score: 114.005 bits (284), Expect = 7.738e-25
Identity = 68/220 (30.91%), Postives = 109/220 (49.55%), Query Frame = 1
Query:   13 IPQLCLNVLSLLTTCASCLEAMVADGXXXXXXXQMLHYAPACREGVXXVLYALASTPELAWAAAKHGGVVYILELLLPSQQEIPLQQRAAAASLLGKLVGQPMHGPRVAITLARFLPDGLVSVIRDGPGEAVVSALEQTTETPELVWTPAMAASLSAQISTMASDLYREQMKGRVVDWDVPEQ-ASAQQEMRDEPQVGGIYVRLFLKDPKFSFEKSKEIL 669
            + QL L V++++T+   C+   +A+         +LH  P+ R+ V   LYAL S+ ++   A   G ++Y+L++   S      Q RA  A L  K+    + GP+V ITL +FLP   +  +RD P EA V   E T E PEL+W       +S  +  M  + ++ Q      +W +PE  A    E   E  VGG+++R+F+  P +   K +E L
Sbjct: 1789 VQQLALEVVNIVTSNQDCVNN-IAESMVLSSLLALLHSLPSSRQLVLETLYALTSSTKIIKEAMAKGALIYLLDMFCNSTHP---QVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNP-EAAVHIFEGTHENPELIWNDNSRDKVSTTVREMMLEHFKNQQDNPEANWKLPEDFAVVFGEAEGELAVGGVFLRIFIAQPAWVLRKPREFL 2003          
The following BLAST results are available for this feature:
BLAST of DC900112 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
DJC13_HUMAN7.738e-2530.91DnaJ homolog subfamily C member 13 OS=Homo sapiens... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900112 VSS Citrus sinensis cDNA clone VS27V26 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900112 ID=DC900112|Name=DC900112|organism=Citrus sinensis|type=EST|length=693bp
CCAGACAGCCACATTCCTCAGCTTTGCCTGAATGTGCTGTCTCTCTTGAC
AACATGCGCTTCCTGCTTGGAGGCTATGGTGGCAGATGGATCTAGTCTTC
TCCTTTTATTACAGATGCTTCATTATGCACCAGCTTGTCGTGAGGGGGTT
NTTNATGTTCTTTATGCTTTGGCAAGCACGCCAGAACTTGCTTGGGCAGC
TGCCAAGCATGGTGGAGTGGTTTACATTCTTGAACTTCTCCTGCCTTCAC
AACAAGAAATTCCATTGCAGCAAAGAGCTGCAGCAGCCTCTTTATTGGGG
AAGCTTGTTGGGCAACCAATGCATGGGCCTAGAGTTGCTATAACACTAGC
AAGGTTTCTCCCAGATGGTCTGGTATCAGTTATAAGAGATGGTCCTGGCG
AAGCTGTTGTATCAGCACTTGAACAGACTACGGAAACCCCAGAACTTGTA
TGGACACCAGCGATGGCAGCTTCTCTATCTGCACAGATTTCAACGATGGC
ATCTGACCTATATCGTGAACAAATGAAAGGACGTGTTGTTGATTGGGATG
TACCTGAGCAGGCATCTGCACAGCAAGAAATGAGAGATGAGCCTCAGGTT
GGCGGAATTTATGTCCGGCTGTTTCTTAAAGATCCAAAATTTTCTTTTGA
GAAATCCAAAGAGATTCTTGGAAGGACTGCTGGATCAGTATTT
back to top