DC900110

Overview
NameDC900110
Unique NameDC900110
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3863 contig Csv1_Contig3863:64..777. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS3_BOVIN (Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.418e-15
Identity = 38/94 (40.43%), Postives = 55/94 (58.51%), Query Frame = -3
Query:  274 LNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 555
            +NH    +  G  K  DW   Q + T ++  S ++DWF G L FQ+EHHLFP +PR   R+++P+V+ LC KH + Y    F  A V  IR+L+
Sbjct:  339 MNHIPREI--GHEKHRDWASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRHNYRRVAPLVKALCAKHGLSYEVKPFLTALVDIIRSLK 430          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS2_MACFA (Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.535e-15
Identity = 36/78 (46.15%), Postives = 49/78 (62.82%), Query Frame = -3
Query:  274 DWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 507
            DWF  Q + T ++  S + DWF G L FQ+EHHLFP +PR  L KI+P+V+ LC KH + Y+      A +  IR+LR
Sbjct:  354 DWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLR 431          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS3_HUMAN (Fatty acid desaturase 3 OS=Homo sapiens GN=FADS3 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.841e-15
Identity = 43/126 (34.13%), Postives = 69/126 (54.76%), Query Frame = -3
Query:  274 VSYLPNW--PERVMFVMASFTVTAIQHIQFC-LNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 642
            +SYLP +  P  ++F +A   + +   +    +NH    +  G  K  DW   Q + T ++  S + +WF G L FQ+EHHLFPR+PR    +++P+V+ LC KH + Y    F  A V  +R+L+
Sbjct:  309 LSYLPFYGVPGVLLFFVAVRVLESHWFVWITQMNHIPKEI--GHEKHRDWVSSQLAATCNVEPSLFTNWFSGHLNFQIEHHLFPRMPRHNYSRVAPLVKSLCAKHGLSYEVKPFLTALVDIVRSLK 432          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS2_PONAB (Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.679e-14
Identity = 35/78 (44.87%), Postives = 49/78 (62.82%), Query Frame = -3
Query:  274 DWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 507
            DWF  Q + T ++  S + DWF G L FQ+EHHLFP +PR  L KI+P+V+ LC KH + Y+      A +  IR+L+
Sbjct:  354 DWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLK 431          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS2_HUMAN (Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.679e-14
Identity = 35/78 (44.87%), Postives = 49/78 (62.82%), Query Frame = -3
Query:  274 DWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 507
            DWF  Q + T ++  S + DWF G L FQ+EHHLFP +PR  L KI+P+V+ LC KH + Y+      A +  IR+L+
Sbjct:  354 DWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIIRSLK 431          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS2_BOVIN (Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.679e-14
Identity = 39/94 (41.49%), Postives = 53/94 (56.38%), Query Frame = -3
Query:  274 LNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 555
            +NH    +   P +  DWF  Q + T ++  S + DWF G L FQ+EHHLFP +PR  L KI+P+VR LC KH + Y+      A    I +LR
Sbjct:  340 MNHIVMEIDREPYR--DWFSSQLAATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVRSLCAKHGIEYQEKPLLRALQDIIGSLR 431          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS2_MOUSE (Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.740e-14
Identity = 36/94 (38.30%), Postives = 54/94 (57.45%), Query Frame = -3
Query:  274 LNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 555
            +NH    + L   +  DWF  Q + T ++  S + DWF G L FQ+EHHLFP +PR  L KI+P+V+ LC KH + Y+      A +  + +L+
Sbjct:  340 MNHLVMEIDLDHYR--DWFSSQLAATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALIDIVSSLK 431          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS2_RAT (Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fads2 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.379e-14
Identity = 36/94 (38.30%), Postives = 54/94 (57.45%), Query Frame = -3
Query:  274 LNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 555
            +NH    + L   +  DWF  Q + T ++  S + DWF G L FQ+EHHLFP +PR  L KI+P+V+ LC KH + Y+      A +  + +L+
Sbjct:  340 MNHIVMEIDLDHYR--DWFSSQLAATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLLRALLDIVSSLK 431          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS3_RAT (Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fads3 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.088e-13
Identity = 36/94 (38.30%), Postives = 53/94 (56.38%), Query Frame = -3
Query:  274 LNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 555
            +NH    +  G  K  DW   Q + T ++  S ++DWF G L FQ+EHHLFP +PR   R+++P+V+  C KH + Y    F  A V  I +L+
Sbjct:  345 MNHIPKEI--GHEKHRDWASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRHNYRRVAPLVKAFCAKHGLHYEVKPFLTALVDIIGSLK 436          
BLAST of DC900110 vs. ExPASy Swiss-Prot
Match: FADS3_MOUSE (Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.088e-13
Identity = 36/94 (38.30%), Postives = 53/94 (56.38%), Query Frame = -3
Query:  274 LNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR 555
            +NH    +  G  K  DW   Q + T ++  S ++DWF G L FQ+EHHLFP +PR   R+++P+V+  C KH + Y    F  A V  I +L+
Sbjct:  345 MNHIPKEI--GHEKHRDWASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRHNYRRVAPLVKAFCAKHGLHYEVKPFLTALVDIIGSLK 436          
The following BLAST results are available for this feature:
BLAST of DC900110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
FADS3_BOVIN4.418e-1540.43Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=... [more]
FADS2_MACFA7.535e-1546.15Fatty acid desaturase 2 OS=Macaca fascicularis GN=... [more]
FADS3_HUMAN9.841e-1534.13Fatty acid desaturase 3 OS=Homo sapiens GN=FADS3 P... [more]
FADS2_PONAB1.679e-1444.87Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 P... [more]
FADS2_HUMAN1.679e-1444.87Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 P... [more]
FADS2_BOVIN1.679e-1441.49Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=... [more]
FADS2_MOUSE3.740e-1438.30Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 P... [more]
FADS2_RAT6.379e-1438.30Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fa... [more]
FADS3_RAT1.088e-1338.30Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fa... [more]
FADS3_MOUSE1.088e-1338.30Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900110 VSS Citrus sinensis cDNA clone VS27V24 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900110 ID=DC900110|Name=DC900110|organism=Citrus sinensis|type=EST|length=713bp
TTACAACTGTGAATACAAAAATATTGCTAGAAAGAGCATTTATTCATCAT
CCTATACGAATGACGACCCCAAGCCAAGAGGCCAAATCAAGAGCCAAAAA
AATATTCGTTGGGGGCAAAATAACTTGTGGCTATAAAATCTCGATAGGCA
TCTGTTANTGTATTTTATATATTAAAAAAAGAAAAACACAACTCAGCCAT
GAGTATTAAGAGCTTCCCAAAGCAAATTCTTGGGGACAGGGTTTGTGAGG
TCCCGAGCTTGCAGAGCAGCACCCCTCAGAGTCCTAATGGTCCACACATT
GGCCTCAAAGAAGGACAAACTTCTGTAAGGCATATTGTGCTTCTTGCAAA
GATCCCTCACCACCGGCGAAATCTTCCTCAATTGGCACCTTGGCAACCTT
GGAAACAAATGATGCTCTAGCTGAAACTGCAACCCACCATGAAACCAATC
CATCCAAGATGAGCAAGCAATATCCAATGTCCCACTTGTTTGCTTCTCAA
ACCAGTCATTCCCTTTAGGCGGACCAAGATACACGTTTGCAGCAAAGTGG
TTTAAACAAAACTGAATGTGTTGGATGGCCGTGACAGTAAAACTTGCCAT
CACAAACATCACCCTTTCAGGCCAGTTTGGTAGATATGAAACTAGAAGTG
GGAACCAAGTCCAAAGACAAGAGTACCCATGATGTTCAAGGCTCTATCTG
GGACCTTACGCTT
back to top