DC900109

Overview
NameDC900109
Unique NameDC900109
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7816 contig Csv1_Contig7816:155..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS2_PONAB (Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.149e-18
Identity = 61/209 (29.19%), Postives = 97/209 (46.41%), Query Frame = 3
Query:   27 QSAALMEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAW--QYLDKLFTGYFV-----QDF-EVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESVW-AHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            + AA  E      + EE++ HN   D W+ I  KVY++T+W+ QHPGG   + + AG+D TDAF A+HP   +  ++L  L  G        QD  + S+I++D+R L        +F+         L  +  +  +  + V    + W + L +  +L     Q+ ++ HD GH  V   PK+N +        L G S  WW   H
Sbjct:    9 EGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWISTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRH 217          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS2_HUMAN (Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.112e-18
Identity = 66/220 (30.00%), Postives = 103/220 (46.82%), Query Frame = 3
Query:   27 QSAALMEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAW--QYLDKLFTGYFV-----QDF-EVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESV-W---AHLGSG--------MLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            + AA  E      + EE++ HN   D W+ I  KVY++T+W+ QHPGG   + + AG+D TDAF A+HP   +  ++L  L  G        QD  + S+I++D+R L        +F K  HV           F++++  ++  ES+ W    + G+G         +L     Q+ ++ HD GH  V   PK+N +        L G S  WW   H
Sbjct:    9 EGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLF-KTNHV----------FFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRH 217          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS2_MACFA (Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.371e-18
Identity = 66/220 (30.00%), Postives = 102/220 (46.36%), Query Frame = 3
Query:   27 QSAALMEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAW--QYLDKLFTGYFV-----QDF-EVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESV-W---AHLGSG--------MLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            + AA  E      + EE++ HN   D W+ I  KVY++T+W+ QHPGG   + + AG+D TDAF A+HP   +  ++L  L  G        QD  + S+I +D+R L        +F K  HV           F++++  ++  ES+ W    + G+G         +L     Q+ ++ HD GH  V   PK+N +        L G S  WW   H
Sbjct:    9 EGAAEREVPMPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSTQHPGGQRVIGHYAGEDATDAFRAFHPDLKFVGKFLKPLLIGELAPEEPSQDHGKNSKIIEDFRALKKTAEDMNLF-KTNHV----------FFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRH 217          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS1_PAPAN (Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.162e-18
Identity = 60/226 (26.55%), Postives = 108/226 (47.79%), Query Frame = 3
Query:   18 PIFQSAALMEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYH--PGTAWQYLDKLFTGYFVQD---FEVS---EISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGV------LCCESVWAHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWK---WTHNGPPHC 644
            P+     +     +Y T +E+   +  E+ W+ I  KVYD++E+ ++HPGG   + + AGQD TD F+A+H   G   +Y++ L  G    +   FE +   E++ ++R L     + G+  K  HV       + L+ ++++ G       +   S    L   +LL    IQ+ ++ HD GH  V ++ K+N +        L G+  +WW    + H+  P+C
Sbjct:    5 PVAAKTPVQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYDISEFTRRHPGGSRVISHYAGQDATDPFVAFHSNKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVEQMGLM-KANHV----FFLLYLLHILLLDGAAWLTLWIFGTSFLPFLLCAVLLTAAQIQAGWLQHDLGHLSVFSTSKWNHLVHHFVIGHLKGVPASWWNHMHFQHHAKPNC 225          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS1_HUMAN (Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.481e-17
Identity = 58/228 (25.44%), Postives = 106/228 (46.49%), Query Frame = 3
Query:   18 PIFQSAALMEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYH--PGTAWQYLDKLFTGYFVQD---FEVS---EISKDYRRLYIEFAKQGMFEKKQ-----HVASCALTCVALMFVVVVYGVLCCESVWAHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWK---WTHNGPPHCLQQ 653
            P+    A      +Y T +E+   +  E+ W+ I  KVY+++E+ ++HPGG   + + AGQD TD F+A+H   G   +Y++ L  G    +   FE +   E++ ++R L     + G+ +        ++    L   A    + V+G     S    L   +LL  +  Q+ ++ HD GH  V ++ K+N +        L G   +WW    + H+  P+C ++
Sbjct:    5 PVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHILLLDGAAWLTLWVFGT----SFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRK 228          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS2_DANRE (Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.547e-17
Identity = 57/198 (28.79%), Postives = 91/198 (45.96%), Query Frame = 3
Query:   66 TAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAWQYLDKLFTGYFVQDFEVSEIS----------KDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESVWAH-LGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            T EE++ H K  D W+ ++ KVY+V++W K+HPGG   L + AG+D T+AF A+HP    Q + K      + + E SE S          +D+R L      +G F+ +    +  L  + L+  +    V    + W + L   ++L     Q+ ++ HD GH  V  +   N +        L G S  WW   H
Sbjct:   22 TWEEVQKHTKHGDQWVVVERKVYNVSQWVKRHPGGLRILGHYAGEDATEAFTAFHPNL--QLVRKYLKPLLIGELEASEPSQDRQKNAALVEDFRALRERLEAEGCFKTQPLFFALHLGHILLLEAIAFMMVWYFGTGWINTLIVAVILATAQSQAGWLQHDFGHLSVFKTSGMNHLVHKFVIGHLKGASAGWWNHRH 217          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS2_BOVIN (Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.947e-16
Identity = 55/209 (26.32%), Postives = 94/209 (44.98%), Query Frame = 3
Query:   27 QSAALMEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAW--QYLDKLFTGYFVQD------FEVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESVW-AHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            + A  +EA       EE++ HN   D W+ I  KVY++T+W+ +HPGG   + + AG+D TDAF+A+H    +  +++  L  G    +       + S+I++D+R L        +F+  Q      L  +  M  +  + +    + W   + +  +L     Q+ ++ HD GH  V     +N I        L G S  WW   H
Sbjct:    9 EGATELEAPMPTFRWEEIQKHNLRTDKWLVIDRKVYNITKWSSRHPGGQRVIGHYAGEDATDAFLAFHRNLDFVRKFMKPLLIGELAPEEPSQDRGKNSQITEDFRALRKTAEDMNLFKSNQLFFLLHLAHIIAMESIAWFTLFYFGNGWIPTIITAFVLATSQAQAGWLQHDYGHLSVYKKSMWNHIVHKFVIGHLKGASANWWNHRH 217          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS2_XENLA (Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.849e-16
Identity = 57/205 (27.80%), Postives = 93/205 (45.37%), Query Frame = 3
Query:   72 EELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAW--QYLDKLFTGYFVQDFEVSEISK------DYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESV-WA---HLGSG--------MLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            EE++ HN   D W+ I+ KVY++++W K+HPGG   + + AG+D TDAF A+HP   +  ++L  L+ G   ++    +  K      D+R L        +F+                F+  ++ +L  E + W    +LG+G        +LL     Q+ ++ HD GH  V    K+N +        L G S  WW   H
Sbjct:   26 EEIQKHNLKTDKWLVIERKVYNISQWVKRHPGGMRIIGHYAGEDATDAFHAFHPDKTFVRKFLKPLYIGELAENEPSQDRDKNAQQVEDFRALRKTAEDMRLFKSN-----------PAFFIFYLFHILLIEFLAWCTLHYLGTGWIPAIITVLLLTISQAQAGWLQHDFGHLSVFEKSKWNHLVHKFVIGHLKGASANWWNHRH 219          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FADS3_BOVIN (Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.575e-16
Identity = 52/194 (26.80%), Postives = 90/194 (46.39%), Query Frame = 3
Query:   72 EELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAW--QYLDKLFTGYFVQDF------EVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESVWA-HLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            E++R HN   D W+ I+ +VYD++ WA++HPGG   + +   +D TDAF A+H   ++  ++L  L  G    +       + +++ +D+R L        +FE K       L  +  M V+    +      W     + ++L     QS  + HD GH  +  + ++N +AQ      L G S  WW + H
Sbjct:   24 EQVRRHNLPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFHAFHQDLSFVRKFLQPLLIGELAPEEPSQDGPQNTQLIEDFRALRQAVEDMKLFEAKPAFFGLLLGHILAMEVLAWLMIYMLGPGWVPSTLAALILAISQAQSWCLQHDLGHTSIFRNSRWNHLAQQFVMGQLKGFSAHWWNFRH 217          
BLAST of DC900109 vs. ExPASy Swiss-Prot
Match: FAD2L_MOUSE (Fatty acid desaturase 2-like protein OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.463e-15
Identity = 60/201 (29.85%), Postives = 89/201 (44.28%), Query Frame = 3
Query:   66 TAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYH--PGTAWQYLDKLFTGYFVQDFEVSEISK------DYRRLYIEFAKQGMFEKK-----QHVASCALTCVALMFVVVVYGVLCCESVW-AHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTH 626
            T +E++ H++  D W+ I  KVY+VT+WA +HPGG   L + AGQD TDAF A H   G    YL  L  G    +    E +K      D+R L        MF         H+A   +  ++   ++  +G     S W   +    LL     Q +++ HD GH  +    K+N +        L G+S  WW + H
Sbjct:   66 TWQEIQRHSQEADQWLVIDRKVYNVTDWAGKHPGGRRVLNHYAGQDATDAFRAMHLDLGMVKLYLKPLLIGELSPEEPSQEKNKNAQLVEDFRELRKTLEAMNMFSANLRFFFLHLAQILILEISAWLILHHFG-----SSWLVTILISFLLTVSQAQCSFLQHDLGHLSMFKKSKWNHLMHKFVMCHLKGLSADWWNYRH 261          
The following BLAST results are available for this feature:
BLAST of DC900109 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
FADS2_PONAB3.149e-1829.19Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 P... [more]
FADS2_HUMAN4.112e-1830.00Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 P... [more]
FADS2_MACFA5.371e-1830.00Fatty acid desaturase 2 OS=Macaca fascicularis GN=... [more]
FADS1_PAPAN9.162e-1826.55Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 P... [more]
FADS1_HUMAN3.481e-1725.44Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 P... [more]
FADS2_DANRE4.547e-1728.79Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE... [more]
FADS2_BOVIN2.947e-1626.32Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=... [more]
FADS2_XENLA3.849e-1627.80Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2... [more]
FADS3_BOVIN8.575e-1626.80Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=... [more]
FAD2L_MOUSE1.463e-1529.85Fatty acid desaturase 2-like protein OS=Mus muscul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900109 VSS Citrus sinensis cDNA clone VS27V24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900109 ID=DC900109|Name=DC900109|organism=Citrus sinensis|type=EST|length=695bp
TTCCCCCACAACACTTTCCAATTTTTCAATCTGCTGCCTTAATGGAGGCC
GAGAAAAAATACATAACGGCTGAAGAGCTTAGAACCCACAACAAGGCAGA
AGATTTGTGGATCTCTATACAGGGGAAAGTTTACGACGTTACAGAATGGG
CAAAACAACATCCTGGCGGCGACGTTCCGCTCTTGAATTTGGCTGGCCAA
GATGTAACCGATGCGTTTATAGCGTATCATCCAGGAACCGCTTGGCAATA
TCTTGATAAACTTTTTACAGGCTATTTTGTTCAAGATTTCGAAGTATCTG
AAATCTCAAAAGATTACAGGAGACTGTACATTGAGTTTGCCAAACAGGGT
ATGTTTGAAAAGAAACAACACGTGGCATCCTGTGCCCTTACATGTGTAGC
ATTGATGTTTGTTGTTGTGGTTTATGGCGTTTTGTGCTGTGAGAGCGTCT
GGGCTCATTTGGGTTCAGGCATGTTGTTGGGGTTTCTTTGGATTCAAAGT
GCTTATGTTGGTCACGATTCCGGGCATTATCAGGTTATGACAAGTCCTAA
GTTTAACAAAATTGCTCAGCTTATTTCAGGAAATTGTTTAACAGGAATCA
GCATTGCTTGGTGGAAGTGGACTCACAATGGCCCACCACATTGCTTGCAA
CAGCCTTGATTACGATCCAAATCTTCACACATCCCAGTTTTTGCG
back to top