DC900106

Overview
NameDC900106
Unique NameDC900106
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length741
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5637 contig Csv1_Contig5637:1..743. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900106 vs. ExPASy Swiss-Prot
Match: GILT_HUMAN (Gamma-interferon-inducible lysosomal thiol reductase OS=Homo sapiens GN=IFI30 PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 8.068e-23
Identity = 69/187 (36.90%), Postives = 98/187 (52.41%), Query Frame = 2
Query:   86 VKLSLYYESLCPYCANFIEFQLVKVFNTDLSTIVNLRLVPYGNAQIRGPDKT--IICQHGQNECYLNTIHACAINAWPDVRIHFKLIQCIEGQASASEQPEAAWRKCCNDL--GFSQQPIDNCYQSGEGTKLTLKYAEETDSLKPPHRFVPWVTVNDQALEEAFQNFIAYVCKAYKGKFLPNACKSS 634
            V ++LYYE+LC  C  F+  +L   +   +  I+N+ LVPYGNAQ +         CQHG+ EC  N + AC ++   D+ + F  I C+E      E  E +   C      G S   I  C     G +L    A+ TD+L+PPH +VPWVTVN + LE+  Q  +  VC+ Y+GK  P+ C SS
Sbjct:   73 VNVTLYYEALCGGCRAFLIRELFPTWLLVME-ILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDEL-DMELAFLTIVCME----EFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQ-LLTLVCQLYQGK-KPDVCPSS 251          
BLAST of DC900106 vs. ExPASy Swiss-Prot
Match: YVRI_CAEEL (GILT-like protein F37H8.5 OS=Caenorhabditis elegans GN=F37H8.5 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 64/187 (34.22%), Postives = 98/187 (52.41%), Query Frame = 2
Query:   65 AAAKSQKVKLSLYYESLCPYCANFIEFQLVKVFNTDLSTIVNLRLVPYGNAQIRGPDKTIICQHGQNECYLNTIHACAINAWPDVRIHFKLIQCIEGQASASEQPEAAWRKCCNDL---GFSQQPIDNCYQSGEGTKLTLKYAEETDSLKP-PHRFVPWVTVNDQALE--EAFQNFI-AYVCKAYKG 604
            AA  +QK+ +++  E+LCP C NF+  QL  +   + +  VN+ LVP+GNA++   D TI CQHG+ EC +N    C I++  D +     + CIE       +   A ++C   L   G  Q+   +C  S  G  L  K A  T ++ P  H+FVPWV +N  +L   + FQN +   +C+ Y G
Sbjct:   69 AATHNQKINITVLIEALCPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAKVL-EDGTIKCQHGEEECSINKFEGCFIDSMQD-QSPLPTLSCIEESLQKKVEFADAVQQCFEKLQIGGDIQRLTQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIINGVSLTSFQGFQNQLPTLLCEWYSG 253          
BLAST of DC900106 vs. ExPASy Swiss-Prot
Match: YKJ2_CAEEL (GILT-like protein C02D5.2 OS=Caenorhabditis elegans GN=C02D5.2 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.087e-15
Identity = 53/186 (28.49%), Postives = 90/186 (48.39%), Query Frame = 2
Query:   86 VKLSLYYESLCPYCANFIEFQLVKVFNTDLSTI--VNLRLVPYGNAQI--RGPDKTIICQHGQNECYLNTIHACAINAWPDVRIHFKLIQCIEGQASASEQPEAAWRKCCNDLGFSQ-QPIDNCYQSGEGTKLTLKYAEETDSLKPPHRFVPWVTVNDQALEEAFQNFIAYVCKAYKGKFLPNACK 628
            VKL +Y E+ CP  + F   QL K ++  L  +  + L ++P+G A+   +G D    CQHG  EC +N +  C I+ +     +   + C++G+ S  E       KC  +   S+ + +  C     G +L     ++T SL P   F+PW+ +N     +A  +    VC+A +   +P+ACK
Sbjct:  139 VKLDVYMEAQCPDTSRFFRQQLKKAWDI-LGRLNRIELNVIPFGKARCTEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPHRYLPGVLCMQGKYSLDEA-----MKCVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVINGSRNSDALYDLTQNVCEAMQP--MPSACK 316          
BLAST of DC900106 vs. ExPASy Swiss-Prot
Match: YO30_CAEBR (GILT-like protein CBG03282 OS=Caenorhabditis briggsae GN=CBG03282 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.084e-11
Identity = 44/180 (24.44%), Postives = 81/180 (45.00%), Query Frame = 2
Query:   80 QKVKLSLYYESLCPYCANFIEFQLVKVFNTDLST-IVNLRLVPYGNAQI-----RGPDKTIICQHGQNECYLNTIHACAINAWPDVRIHFKLIQCIEGQASASEQPEAAWRKCCNDLG-FSQQPIDNCYQSGEGTKLTLKYAEETDSLKPPHRFVPWVTVNDQALEEAFQNFIAYVCKAY 598
            +KV +  + E  C   + ++++  + ++    ST  +N    PYG          G D    C HG  EC LN + AC I A P+   + +++ CI+G+ + S   EA    C N+     +  + +C  S  G KL   +      + P   + PW+ +N +  +EA ++   ++C  +
Sbjct:   31 EKVNIVAFGEGRCSDTSFWMKWHWLPMWRMLGSTGRINFEYHPYGIKTTCVDSDSGDDVVCECHHGARECLLNQLQACVIEALPNFEEYMEVVTCIQGKQNISMAAEA----CFNEPSKLERAKMMSCADSRHGRKLFSDHENFVAQMAPEMDWAPWILINGKRYKEAEEDLWQFLCDRF 206          
The following BLAST results are available for this feature:
BLAST of DC900106 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
GILT_HUMAN8.068e-2336.90Gamma-interferon-inducible lysosomal thiol reducta... [more]
YVRI_CAEEL5.782e-2134.22GILT-like protein F37H8.5 OS=Caenorhabditis elegan... [more]
YKJ2_CAEEL8.087e-1528.49GILT-like protein C02D5.2 OS=Caenorhabditis elegan... [more]
YO30_CAEBR7.084e-1124.44GILT-like protein CBG03282 OS=Caenorhabditis brigg... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900106 VSS Citrus sinensis cDNA clone VS27V21 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900106 ID=DC900106|Name=DC900106|organism=Citrus sinensis|type=EST|length=741bp
CCCCTTTGTTCTAAGCATTCTGCTGCTCATCTTCATCTCTCCATCTCTTT
CTTTCAGTGAAGATGCTGCTGCTAAATCTCAGAAAGTGAAACTTTCTTTA
TACTATGAAAGTTTGTGTCCATATTGTGCCAATTTCATAGAATTTCAACT
AGTTAAAGTTTTTAATACCGATCTTAGCACCATTGTCAACTTAAGGCTAG
TCCCCTATGGCAATGCTCAAATCAGAGGACCTGACAAAACTATCATTTGC
CAGCATGGCCAAAATGAATGCTACTTGAATACCATACATGCCTGTGCCAT
TAACGCCTGGCCTGATGTCAGAATACATTTCAAACTTATCCAGTGCATAG
AAGGTCAAGCCTCTGCGAGCGAACAACCAGAAGCAGCATGGAGAAAATGT
TGCAATGATCTGGGATTCAGTCAGCAACCAATTGACAATTGCTATCAAAG
TGGTGAAGGAACTAAGCTTACACTGAAATATGCTGAGGAAACAGATTCTC
TAAAGCCACCGCATAGATTTGTGCCATGGGTGACTGTGAACGATCAAGCA
CTTGAAGAAGCTTTCCAAAATTTTATAGCCTACGTCTGCAAAGCATACAA
AGGCAAATTTCTACCAAATGCCTGCAAATCAAGTCAGCAGGAATCAACTC
CAGGGAAGCATCAATTCTTCCAGTCTGCTACAAATCCTCAATGGTTGCGA
CAGAGAGAGTCCCACATCAGCAGAGACTTCAATGGAGATGG
back to top