DC900105

Overview
NameDC900105
Unique NameDC900105
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length776
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP21_MAIZE (Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 4.688e-85
Identity = 146/223 (65.47%), Postives = 184/223 (82.51%), Query Frame = 1
Query:   31 YPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAH 699
            +PP  L+KV++E+++T+LLVFVTCG+A +   D+ R+S+LG SVAGGLIVTVMIYAVGHISGAHMNPAVTLAFA  RHFPW QVP Y AAQ TG++ AS  L+ +LHPI  +GTT+P+G    +L++EI+VTF+MMFVT AVATDT+A+GELAG+AVGSAVCITS+ AG VSGGSMNPART+GPA+AS+ Y G+W+Y +GP  GT  GAW+Y  IR  + P+H
Sbjct:   41 FPPHLLKKVVSEVVSTFLLVFVTCGAAGIYGSDKDRISQLGQSVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVFRHFPWIQVPFYWAAQFTGSICASFVLKAVLHPIAVLGTTTPTGPHWHSLVIEIIVTFNMMFVTLAVATDTRAVGELAGLAVGSAVCITSIFAGAVSGGSMNPARTLGPALASNLYTGLWIYFLGPVLGTLSGAWTYTYIRFEEAPSH 263          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP21_ORYSJ (Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica GN=NIP2-1 PE=1 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.327e-84
Identity = 145/229 (63.32%), Postives = 184/229 (80.35%), Query Frame = 1
Query:   25 EHYPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHAISQ 711
            + +PP  L+KV++E++AT+LLVF+TCG+A +S  D  R+S+LG S+AGGLIVTVMIYAVGHISGAHMNPAVTLAFA  RHFPW QVP Y AAQ TGA+ AS  L+ ++HP+  IGTT+P G    +L++E++VTF+MMFVT AVATDT+A+GELAG+AVGSAVCITS+ AG +SGGSMNPART+GPA+AS+ + G+W+Y +GP  GT  GAW+Y  IR  D P    SQ
Sbjct:   41 DFFPPHLLKKVVSEVVATFLLVFMTCGAAGISGSDLSRISQLGQSIAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVFRHFPWIQVPFYWAAQFTGAICASFVLKAVIHPVDVIGTTTPVGPHWHSLVVEVIVTFNMMFVTLAVATDTRAVGELAGLAVGSAVCITSIFAGAISGGSMNPARTLGPALASNKFDGLWIYFLGPVMGTLSGAWTYTFIRFEDTPKEGSSQ 269          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP22_ORYSJ (Aquaporin NIP2-2 OS=Oryza sativa subsp. japonica GN=NIP2-2 PE=2 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.970e-83
Identity = 147/224 (65.62%), Postives = 182/224 (81.25%), Query Frame = 1
Query:   31 YPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHA 702
            +PP  L+KVI+E++AT+LLVFVTCG+A++   D  R+S+LG SV GGLIVTVMIYA GHISGAHMNPAVTL+FA  RHFPW QVP Y AAQ TGA+ A+  LR +L+PI+ +GTT+P+G    AL++EIVVTF+MMFVT AVATD++A+GELAG+AVGSAVCITS+ AGPVSGGSMNPART+ PA+AS+ Y G+W+Y +GP  GT  GAW Y  IR  + PA A
Sbjct:   46 FPPNLLKKVISEVVATFLLVFVTCGAASIYGEDMKRISQLGQSVVGGLIVTVMIYATGHISGAHMNPAVTLSFAFFRHFPWIQVPFYWAAQFTGAMCAAFVLRAVLYPIEVLGTTTPTGPHWHALVIEIVVTFNMMFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVYTGLWIYFLGPVVGTLSGAWVYTYIRFEEAPAAA 269          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP22_MAIZE (Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 4.388e-83
Identity = 147/222 (66.22%), Postives = 180/222 (81.08%), Query Frame = 1
Query:   31 YPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPA 696
            +PP   +KVI+E++AT+LLVFVTCG+A++   D  R+S+LG SVAGGLIVTVMIYA GHISGAHMNPAVTL+FA  RHFPW QVP Y AAQ TGA+ A+  L+ +LHPI  IGTT+PSG    AL++EIVVTF+MMFVT AVATD++A+GELAG+AVGSAVCITS+ AGPVSGGSMNPART+ PA+AS+ + G+W+Y +GP  GT  GAW Y  IR  + PA
Sbjct:   46 FPPHLGKKVISEVVATFLLVFVTCGAASIYGEDNRRISQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMCAAFVLKAVLHPIAVIGTTTPSGPHWHALLIEIVVTFNMMFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVIGTLSGAWVYTYIRFEEAPA 267          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP23_MAIZE (Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 5.731e-83
Identity = 151/241 (62.66%), Postives = 186/241 (77.18%), Query Frame = 1
Query:   31 YPPGFLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHAISQARYRSTCRLXSMSS 753
            +PP   +KVI+E++AT+LLVFVTCG+A++   D  R+S+LG SVAGGLIVTVMIYA GHISGAHMNPAVTL+FA  RHFPW QVP Y AAQ TGA+ A+  L+ +L PI  IGTT+PSG    AL +EIVVTF+MMFVT AVATD++A+GELAG+AVGSAVCITS+ AGPVSGGSMNPART+ PA+AS+ + G+W+Y +GP  GT  GAW Y  IR  + PA A    +  S+ +L  M S
Sbjct:   49 FPPHLGKKVISEVVATFLLVFVTCGAASIYGEDNARISQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMCAAFVLKAVLQPIAVIGTTTPSGPHWHALAIEIVVTFNMMFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVVGTLSGAWVYTYIRFEEAPAAAKPDTQRLSSFKLRRMQS 289          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP11_ORYSJ (Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica GN=NIP1-1 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.874e-66
Identity = 118/225 (52.44%), Postives = 164/225 (72.89%), Query Frame = 1
Query:   43 FLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPI-KHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHAISQA 714
            F++K+IAEI  TY L+F  CG+  ++     +++  G ++  GL V VM+YAVGHISGAH NPAVTLAFA  R FPW+QVP YAAAQ+ GA  A+ TLR++     +H   T P+GSD+Q+L++E ++TF +MFV S VATD +AIGELAG+AVG+ + +  ++AGP+SG SMNPAR++GPA+    Y+ IWVY+VGP  G   GAW+YN+IR T+KP   I+++
Sbjct:   46 FIQKIIAEIFGTYFLIFAGCGAVTINQSKNGQITFPGVAIVWGLAVMVMVYAVGHISGAHFNPAVTLAFATCRRFPWRQVPAYAAAQMLGATLAAGTLRLMFGGRHEHFPGTLPAGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVLIAGPISGASMNPARSLGPAMIGGEYRSIWVYIVGPVAGAVAGAWAYNIIRFTNKPLREITKS 270          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP11_MAIZE (Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 8.313e-66
Identity = 124/240 (51.67%), Postives = 170/240 (70.83%), Query Frame = 1
Query:   43 FLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPI-KHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHAISQAR--YRSTCRLXSMSS 753
            F++K+IAEI  TY L+F  CG+  ++A    +++  G ++  GL V VM+YAVGHISGAH NPAVTLAFA    FPW+Q+P Y  AQ+ GA  AS TLR++     +H   T P+GS++Q+L++EI+ TF +MFV S VATD +AIGELAG+AVG+ + +  ++AGPVSG SMNPAR+VGPA+ S  Y  IWVY+VGP  G   GAW+YN+IR T+KP   I+++    +ST R+ S +S
Sbjct:   42 FIQKIIAEIFGTYFLMFAGCGAVTINASKNGQITFPGVAIVWGLAVMVMVYAVGHISGAHFNPAVTLAFATSGRFPWRQLPAYVLAQMLGATLASGTLRLMFGGRHEHFPGTLPTGSEVQSLVIEIITTFYLMFVISGVATDNRAIGELAGLAVGATILLNVLIAGPVSGASMNPARSVGPALVSGEYTSIWVYVVGPVVGAVAGAWAYNLIRFTNKPLREITKSTSFLKSTSRMNSAAS 281          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP13_ORYSJ (Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica GN=NIP1-3 PE=3 SV=2)

HSP 1 Score: 247.284 bits (630), Expect = 7.038e-65
Identity = 125/234 (53.42%), Postives = 161/234 (68.80%), Query Frame = 1
Query:   43 FLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPI-KHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHAISQAR--YRSTCR 735
            F +KVIAEI+ T+ L+F  C + A++      V+  G  +  GL V VM+Y+VGHISGAH+NPAVTLAFA    FPW++VP YAAAQ+ G+ +AS  LR L     +H   T+P+GSD+Q+L ME ++TF +MFV S VATD +AIGELAG+AVG+ V +  + AGP+SG SMNPART+GPAI    Y GIWVY+ GP  G   GAW+YN+IR TDKP   I+      RST R
Sbjct:   52 FAQKVIAEILGTFFLIFAGCAAVAVNKRTGGTVTFPGICITWGLAVMVMVYSVGHISGAHLNPAVTLAFATCGRFPWRRVPAYAAAQVAGSAAASAALRALFGGAPEHFFGTAPAGSDVQSLAMEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLVNVLFAGPISGASMNPARTIGPAIILGRYTGIWVYIAGPVFGAVAGAWAYNLIRFTDKPLREITMTASFIRSTRR 285          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP42_ARATH (Probable aquaporin NIP4-2 OS=Arabidopsis thaliana GN=NIP4-2 PE=2 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 6.165e-61
Identity = 118/224 (52.68%), Postives = 156/224 (69.64%), Query Frame = 1
Query:   49 RKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLH--PIKHIGTTSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHAISQA 714
            +K+IAE+I TY ++F  CG   ++      ++  G  V  GLIV VMIY+ GHISGAH NPAVT+ FA  R FPW QVP+Y  AQLTG++ ASLTLR++ +  P    GTT P+ S  QAL+ EI+++F +MFV S VATD++A GELAGIAVG  + +   +AGP+SG SMNPAR++GPAI    YKGIWVY+VGP  G F G + YN +R TDKP   ++++
Sbjct:   43 QKLIAEMIGTYFIIFSGCGVVVVNVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAVFRRFPWYQVPLYIGAQLTGSLLASLTLRLMFNVTPKAFFGTT-PTDSSGQALVAEIIISFLLMFVISGVATDSRATGELAGIAVGMTIILNVFVAGPISGASMNPARSLGPAIVMGRYKGIWVYIVGPFVGIFAGGFVYNFMRFTDKPLRELTKS 265          
BLAST of DC900105 vs. ExPASy Swiss-Prot
Match: NIP12_ARATH (Aquaporin NIP1-2 OS=Arabidopsis thaliana GN=NIP1-2 PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 8.052e-61
Identity = 111/232 (47.84%), Postives = 161/232 (69.40%), Query Frame = 1
Query:   43 FLRKVIAEIIATYLLVFVTCGSAALSAYDEHRVSKLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPIYAAAQLTGAVSASLTLRVLLHPIKHIGT--------TSPSGSDLQALIMEIVVTFSMMFVTSAVATDTKAIGELAGIAVGSAVCITSVLAGPVSGGSMNPARTVGPAIASSFYKGIWVYLVGPXTGTFMGAWSYNMIRETDKPAHAISQA 714
            FL+K++AE++ TY L+F  C + A++   +  V+  G ++  GL V V++Y++GHISGAH NPAVT+AFA+   FP KQVP Y  +Q+ G+  A+ TLR+L    + + +        T PSGS+LQ+ ++E ++TF +MFV S VATD +AIGELAG+AVGS V +  ++AGPVSG SMNP R++GPA+  S Y+G+W+Y+V P  G   GAW YNM+R TDKP   I+++
Sbjct:   50 FLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTLPSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKS 281          
The following BLAST results are available for this feature:
BLAST of DC900105 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 219
Match NameE-valueIdentityDescription
NIP21_MAIZE4.688e-8565.47Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2 SV=2[more]
NIP21_ORYSJ2.327e-8463.32Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica G... [more]
NIP22_ORYSJ1.970e-8365.63Aquaporin NIP2-2 OS=Oryza sativa subsp. japonica G... [more]
NIP22_MAIZE4.388e-8366.22Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1[more]
NIP23_MAIZE5.731e-8362.66Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1[more]
NIP11_ORYSJ4.874e-6652.44Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica G... [more]
NIP11_MAIZE8.313e-6651.67Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2 SV=1[more]
NIP13_ORYSJ7.038e-6553.42Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica G... [more]
NIP42_ARATH6.165e-6152.68Probable aquaporin NIP4-2 OS=Arabidopsis thaliana ... [more]
NIP12_ARATH8.052e-6147.84Aquaporin NIP1-2 OS=Arabidopsis thaliana GN=NIP1-2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900105 VSS Citrus sinensis cDNA clone VS27V20 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900105 ID=DC900105|Name=DC900105|organism=Citrus sinensis|type=EST|length=776bp
CCAAAACTATGCCTTGTTTGGAATGAACATTATCCTCCTGGTTTCCTCAG
AAAGGTTATTGCTGAGATAATAGCAACATATTTGCTGGTTTTTGTGACCT
GTGGCTCAGCTGCTTTGAGTGCATATGATGAACATAGAGTATCAAAGCTT
GGAGCCTCGGTTGCTGGGGGACTCATTGTCACCGTAATGATCTATGCAGT
TGGTCACATCTCTGGTGCTCATATGAATCCTGCTGTCACTCTAGCTTTTG
CTGCTGTTAGACATTTTCCCTGGAAACAGGTCCCAATTTATGCAGCAGCT
CAACTAACAGGAGCTGTATCGGCTTCCCTCACACTGCGTGTCCTATTACA
CCCAATCAAACATATTGGCACAACATCACCTTCTGGATCAGATCTCCAAG
CCCTAATCATGGAAATTGTTGTCACCTTTTCTATGATGTTCGTCACTTCA
GCCGTCGCAACTGACACCAAAGCTATAGGAGAGCTAGCAGGTATTGCAGT
TGGTTCTGCAGTTTGCATAACATCTGTTTTGGCGGGACCAGTATCGGGTG
GATCTATGAACCCAGCAAGGACAGTAGGACCGGCAATTGCTAGTTCATTC
TATAAAGGGATTTGGGTGTATTTGGTCGGACCGGNTACTGGAACTTTCAT
GGGAGCATGGTCTTACAATATGATCCGGGAGACCGATAAGCCAGCCCATG
CAATTTCCCAGGCTCGGTATCGGTCAACTTGCCGGCTGNAAAGTATGAGC
AGCTACAGAAGACCTTTGAGCTTGTA
back to top