DC900103

Overview
NameDC900103
Unique NameDC900103
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length668
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8932 contig Csv1_Contig8932:41..709. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: ZB14_MAIZE (14 kDa zinc-binding protein OS=Zea mays GN=ZBP14 PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.519e-54
Identity = 105/129 (81.40%), Postives = 116/129 (89.92%), Query Frame = -3
Query:  202 MASXNEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 588
            M+S  EAA+  +  DSPTIFDKII KEIPS VVYED+KVLAFRDI+PQAPTHILIIPKVKDGLTGL+KAEERH EILG LLY AK+VAKQEGLEDG+R+VINDGP+G QSV+HIHV LLGGRQMNWPPG
Sbjct:    1 MSSEKEAALRRL-DDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLAKAEERHIEILGYLLYVAKVVAKQEGLEDGYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG 128          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: ZB14_BRAJU (14 kDa zinc-binding protein (Fragment) OS=Brassica juncea PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 7.098e-49
Identity = 93/112 (83.04%), Postives = 101/112 (90.18%), Query Frame = -3
Query:  202 TIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 537
            TIF KII+KEIPS VVYEDDKVLAFRDI PQ P HIL+IPKV+DGLTGL KAEERH +ILGRLLY AKLVAKQEGL++GFRIVINDGP G QSV+HIHV L+GGRQMNWPPG
Sbjct:    2 TIFGKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLFKAEERHIDILGRLLYTAKLVAKQEGLDEGFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG 113          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: HINT2_BOVIN (Histidine triad nucleotide-binding protein 2, mitochondrial OS=Bos taurus GN=HINT2 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.345e-31
Identity = 64/124 (51.61%), Postives = 89/124 (71.77%), Query Frame = -3
Query:  202 EAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 573
            +A  AA    +PTIF +I+++ +P+ ++YED + LAFRD+ PQAP H L+IPK    +  +S+AEE   ++LG LL  AK  AK EGL DG+R+VINDG  G QSV+H+H+ +LGGRQ+ WPPG
Sbjct:   42 KAQQAAPGGAAPTIFSRILDRSLPADILYEDQQCLAFRDVAPQAPVHFLVIPKKP--IPRISQAEEEDQQLLGHLLLVAKETAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG 163          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: HINT2_HUMAN (Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens GN=HINT2 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.756e-31
Identity = 68/135 (50.37%), Postives = 92/135 (68.15%), Query Frame = -3
Query:  202 AVVMASXNEAAVA--AVPSDS-PTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 597
            A  +   NE A A  A P  + PTIF +I++K +P+ ++YED + L FRD+ PQAP H L+IPK    +  +S+AEE   ++LG LL  AK  AK EGL DG+R+VINDG  G QSV+H+H+ +LGGRQ+ WPPG
Sbjct:   31 AAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKP--IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG 163          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: Y1390_SYNE7 (Uncharacterized HIT-like protein Synpcc7942_1390 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1390 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.294e-31
Identity = 64/112 (57.14%), Postives = 80/112 (71.43%), Query Frame = -3
Query:  202 TIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 537
            TIF KII +EIP+ +VYEDD  LAFRD+ PQAP HIL+IPK    +  L +A   H  +LG LL   K +A QEGL +G+R VIN GP GGQ+V+H+H+ LLGGR + WPPG
Sbjct:    5 TIFGKIIRREIPADIVYEDDLCLAFRDVAPQAPVHILVIPK--QPIANLLEATAEHQALLGHLLLTVKAIAAQEGLTEGYRTVINTGPAGGQTVYHLHIHLLGGRSLAWPPG 114          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: HINT1_BOVIN (Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.294e-31
Identity = 63/112 (56.25%), Postives = 84/112 (75.00%), Query Frame = -3
Query:  202 TIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 537
            TIF KII KEIP+K++YEDD+ LAF DI PQAPTH L+IPK    ++ +S AE+    +LG L+   K  A   GL+ G+R+V+N+G +GGQSV+H+H+ +LGGRQMNWPPG
Sbjct:   17 TIFGKIIRKEIPAKIIYEDDQCLAFHDISPQAPTHFLVIPKKY--ISQISAAEDDDESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: HINT1_RABIT (Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 3.913e-31
Identity = 62/112 (55.36%), Postives = 84/112 (75.00%), Query Frame = -3
Query:  202 TIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 537
            TIF KII KEIP+K+++EDD+ LAF DI PQAPTH L+IPK    ++ +S AE+    +LG L+   K  A   GL+ G+R+V+N+G +GGQSV+H+H+ +LGGRQMNWPPG
Sbjct:   17 TIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKH--ISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: HINT_CAEEL (Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.675e-31
Identity = 62/132 (46.97%), Postives = 94/132 (71.21%), Query Frame = -3
Query:  202 MASXNEAAVAAVPSD---SPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 588
            M+  ++A +AA+  D   + T+F KII KEIP+K+++EDD+ LAF D+ PQAP H L+IPK +  +  L  A +    ++G+L+  A  VAKQ G+ +G+R+V+N+G +G QSVFH+H+ +LGGRQ+ WPPG
Sbjct:    1 MSEVDKAHLAAINKDVQANDTLFGKIIRKEIPAKIIFEDDEALAFHDVSPQAPIHFLVIPKRRIDM--LENAVDSDAALIGKLMVTASKVAKQLGMANGYRVVVNNGKDGAQSVFHLHLHVLGGRQLQWPPG 130          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: HINT2_MOUSE (Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus GN=Hint2 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.675e-31
Identity = 60/124 (48.39%), Postives = 90/124 (72.58%), Query Frame = -3
Query:  202 EAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 573
            +A  AA    SPTIF +I+++ +P+ ++YED + L FRD+ PQAP H L+IP+    +  +S+AEE   ++LG LL  AK +A+ +GL+DG+R+V+NDG  G QSV+H+H+ +LGGRQ+ WPPG
Sbjct:   42 KAQKAAPGGASPTIFSRILDRSLPADILYEDQQCLVFRDVAPQAPVHFLVIPRKP--IPRISQAEEDDQQLLGHLLLVAKKIAQAQGLKDGYRLVVNDGKMGAQSVYHLHIHVLGGRQLQWPPG 163          
BLAST of DC900103 vs. ExPASy Swiss-Prot
Match: HINT1_RAT (Histidine triad nucleotide-binding protein 1 OS=Rattus norvegicus GN=Hint1 PE=1 SV=5)

HSP 1 Score: 133.65 bits (335), Expect = 8.717e-31
Identity = 67/129 (51.94%), Postives = 89/129 (68.99%), Query Frame = -3
Query:  202 MASXNEAAVAAVPSDSPTIFDKIINKEIPSKVVYEDDKVLAFRDIDPQAPTHILIIPKVKDGLTGLSKAEERHCEILGRLLYXAKLVAKQEGLEDGFRIVINDGPNGGQSVFHIHVXLLGGRQMNWPPG 588
            MA     A  A P    TIF KII KEIP+K+++EDD+ LAF DI PQAPTH L+IPK    ++ +S A++    +LG L+   K  A   GL+ G+R+V+N+G +GGQSV+HIH+ +LGGRQMNWPPG
Sbjct:    1 MADEIAKAQVAQPGGD-TIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQISVADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG 126          
The following BLAST results are available for this feature:
BLAST of DC900103 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
ZB14_MAIZE2.519e-5481.4014 kDa zinc-binding protein OS=Zea mays GN=ZBP14 P... [more]
ZB14_BRAJU7.098e-4983.0414 kDa zinc-binding protein (Fragment) OS=Brassica... [more]
HINT2_BOVIN1.345e-3151.61Histidine triad nucleotide-binding protein 2, mito... [more]
HINT2_HUMAN1.756e-3150.37Histidine triad nucleotide-binding protein 2, mito... [more]
Y1390_SYNE72.294e-3157.14Uncharacterized HIT-like protein Synpcc7942_1390 O... [more]
HINT1_BOVIN2.294e-3156.25Histidine triad nucleotide-binding protein 1 OS=Bo... [more]
HINT1_RABIT3.913e-3155.36Histidine triad nucleotide-binding protein 1 OS=Or... [more]
HINT_CAEEL6.675e-3146.97Histidine triad nucleotide-binding protein 1 OS=Ca... [more]
HINT2_MOUSE6.675e-3148.39Histidine triad nucleotide-binding protein 2, mito... [more]
HINT1_RAT8.717e-3151.94Histidine triad nucleotide-binding protein 1 OS=Ra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900103 VSS Citrus sinensis cDNA clone VS27V18 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900103 ID=DC900103|Name=DC900103|organism=Citrus sinensis|type=EST|length=668bp
CGACAAACCACACCCTTATTATTGAAGGTCTTTTTCTCCTTTCAGCACAA
TGTCATTTCACATCATATCAAATAATGNGGCTCAAAGCAGCCACCAATTA
GTTTGTTATTTGAAGCTCGATGCAGCTTGATGCATATTAAAGTNCAAAGG
GCATAATCATTTTTTCATAAGAGAATCTGGCNCCCAAAATACTTCATCTT
AGCCCGGGGGCCAGTTCATTTGTCGTCCTCCTAGGAGGNGGACGTGGATG
TGAAAAACTGATTGACCTCCATTTGGCCCATCATTAATCACAATCCTAAA
GCCGTCTTCTAGTCCTTCCTGTTTAGCAACAAGCTTAGCAGNGTAAAGAA
GGCGGCCAAGAATTTCGCAATGCCTTTCCTCGGCCTTTGAAAGTCCAGTC
AAGCCATCCTTCACTTTGGGAATAATTAGAATGTGTGTAGGAGCTTGGGG
ATCTATGTCCCTAAAGGCTAAGACCTTATCATCCTCATAAACAACTTTAG
ATGGGATTTCTTTGTTAATTATTTTGTCAAATATGGTAGGCGAATCAGAA
GGAACGGCTGCAACAGCAGCCTCGTTCTNTGAAGCCATGACGACGGCAGA
CAAATGAGACGTCAGCACTGCAAGTCGGCTGCTTGTGCTTGCTGCATTGC
CAACATCCGAGGCGGTGG
back to top