DC900098

Overview
NameDC900098
Unique NameDC900098
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length724
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900098_ssr466 microsatellite DC900098_ssr466:466..479. BLAST: Citrus ESTs to Prunus persica proteins V1
DC900098_ssr555 microsatellite DC900098_ssr555:555..572. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig898 contig Csv1_Contig898:9..733. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900098 vs. ExPASy Swiss-Prot
Match: ARG7_PHAAU (Indole-3-acetic acid-induced protein ARG7 OS=Phaseolus aureus GN=ARG7 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.518e-18
Identity = 42/67 (62.69%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  176 LDVPKGHFVVYVGENRSRYIIPITFLTRPEFQSLLQQAEEEFGFDHDM-GLTIPCEEQVFQSLTSML 373
            LD PKG+  VYVGEN  R++IP++ L +P FQ LL QAEEEFG+DH M GLTIPC E +FQ +TS L
Sbjct:   23 LDAPKGYLAVYVGENMKRFVIPVSHLNQPLFQDLLSQAEEEFGYDHPMGGLTIPCSEDLFQHITSCL 89          
BLAST of DC900098 vs. ExPASy Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.819e-18
Identity = 41/66 (62.12%), Postives = 50/66 (75.76%), Query Frame = 2
Query:  179 DVPKGHFVVYVGENRSRYIIPITFLTRPEFQSLLQQAEEEFGFDHDM-GLTIPCEEQVFQSLTSML 373
            D PKG+  VYVGE   R++IP+++L +P FQ LL QAEEEFG+DH M GLTIPC E VFQ +TS L
Sbjct:   16 DAPKGYLAVYVGEKLKRFVIPVSYLNQPSFQDLLSQAEEEFGYDHPMGGLTIPCSEDVFQCITSCL 81          
BLAST of DC900098 vs. ExPASy Swiss-Prot
Match: AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.857e-17
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  176 LDVPKGHFVVYVGENRSRYIIPITFLTRPEFQSLLQQAEEEFGFDHDM-GLTIPCEEQVFQSLTSML 373
            +D PKG+  VYVGE   R++IP++++ +P FQ LL QAEEEFG+DH M GLTIPC E+VFQ +T  L
Sbjct:   15 VDAPKGYLAVYVGEKMKRFVIPVSYMNQPSFQDLLTQAEEEFGYDHPMGGLTIPCSEEVFQRITCCL 81          
BLAST of DC900098 vs. ExPASy Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.852e-16
Identity = 39/67 (58.21%), Postives = 53/67 (79.10%), Query Frame = 2
Query:  176 LDVPKGHFVVYVGENRSRYIIPITFLTRPEFQSLLQQAEEEFGFDHDM-GLTIPCEEQVFQSLTSML 373
            ++VPKG+ VVYVG+   R++IP+++L +P FQ LL QAEEEFG+DH M GLTIPC+E  F ++TS L
Sbjct:   23 VEVPKGYLVVYVGDKMRRFLIPVSYLNQPSFQDLLNQAEEEFGYDHPMGGLTIPCKEDEFLTVTSHL 89          
BLAST of DC900098 vs. ExPASy Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.125e-16
Identity = 39/67 (58.21%), Postives = 50/67 (74.63%), Query Frame = 2
Query:  176 LDVPKGHFVVYVGENRSRYIIPITFLTRPEFQSLLQQAEEEFGFDH-DMGLTIPCEEQVFQSLTSML 373
            +DV KG+  VYVGE   R++IP+++L +P FQ LL QAEEEFG+ H + GLTIPC E VFQ +TS L
Sbjct:   23 VDVEKGYLAVYVGEKMRRFVIPVSYLNKPSFQDLLSQAEEEFGYHHPNGGLTIPCSEDVFQHITSFL 89          
BLAST of DC900098 vs. ExPASy Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.200e-15
Identity = 38/67 (56.72%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  176 LDVPKGHFVVYVGENRSRYIIPITFLTRPEFQSLLQQAEEEFGFDHDM-GLTIPCEEQVFQSLTSML 373
            +DVPKG+  VYVG+   R+ IP+++L  P FQ LL QAEEEFG+DH M GLTIPC+E+ F ++T+ L
Sbjct:   24 VDVPKGYAAVYVGDKMRRFTIPVSYLNEPSFQELLSQAEEEFGYDHPMGGLTIPCKEEEFLNVTAHL 90          
The following BLAST results are available for this feature:
BLAST of DC900098 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ARG7_PHAAU7.518e-1862.69Indole-3-acetic acid-induced protein ARG7 OS=Phase... [more]
AX15A_SOYBN9.819e-1862.12Auxin-induced protein 15A OS=Glycine max PE=2 SV=1[more]
AXX15_SOYBN2.857e-1758.21Auxin-induced protein X15 OS=Glycine max PE=2 SV=1[more]
AX10A_SOYBN1.852e-1658.21Auxin-induced protein X10A OS=Glycine max PE=2 SV=... [more]
AX6B_SOYBN4.125e-1658.21Auxin-induced protein 6B OS=Glycine max PE=2 SV=1[more]
A10A5_SOYBN1.200e-1556.72Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900098 VSS Citrus sinensis cDNA clone VS27V14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900098 ID=DC900098|Name=DC900098|organism=Citrus sinensis|type=EST|length=724bp
GAAACTTCTCTCAGAGCTCTTCTTCTCTAGTGCCATTAATTACCCGCACA
AGTTCTTCATTAGGATGGCCATCAGAAAATCAAACAAGTTGTCTCAAACG
GCTGTGATTAAGCAAATTCTCAAGAGATGCTCGAGCTTGGGGAAGAAACA
AAGCTACGATGAACAAGGACTCCCTTTAGATGTCCCAAAAGGTCATTTTG
TTGTGTATGTTGGTGAAAACAGAAGCAGATACATCATCCCAATAACTTTC
TTGACTCGTCCTGAGTTTCAAAGCCTGCTTCAACAAGCCGAAGAAGAATT
TGGCTTTGATCATGACATGGGCTTAACCATTCCCTGTGAAGAACAAGTGT
TCCAGTCCTTAACATCAATGCTCAGATAAGAAGAATATTGCCGAGCTACG
CTGCTAGGGTACTTGCTTGTTTGTTTTTGGAGAAATTGGCTGATGATGAA
GCTGCTTCAATTGCTTCTCTCTCTCTCTCTTTTTTTCCTTTTTTCTTTTT
CTTTTACAGTAAATCTAACCCGGCCAACGAAGAATTAATATTTTAACCCA
TGGATATTATTATTATTATTATCTGGGTTAACTATTTTAGAGTTGTAAAT
CTCAAAAGTAAACTTATTAGCATTTTCCTCACTGTGGACTCTGGTGTGTG
GTGTTGTTGTATACTACCAATGTACCCTGTGAGAGATCTAAATATTAAAT
TAAGCTCTACCTTCTTTTTTCCTT
back to top