DC900097

Overview
NameDC900097
Unique NameDC900097
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length708
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900097_ssr167 microsatellite DC900097_ssr167:167..178. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RBP9X_DROME (Ran-binding proteins 9/10 homolog OS=Drosophila melanogaster GN=RanBPM PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.933e-20
Identity = 46/117 (39.32%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  243 VSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            +S + L V Y  V     D   V+   P P    +YYFE+ +   G  G + IG T++ F+M R PGW+  S GYHGDDG  +   G G+ +GPTFTT D +G  +N+     F+TK
Sbjct:  433 LSQNNLRVTYKGVGKQHSDAASVRTAYPIPSSCGLYYFEVRIISKGRNGYMGIGLTAQQFRMNRLPGWDKQSYGYHGDDGNSFSSSGNGQTYGPTFTTGDVIGCCVNFVNNTCFYTK 549          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RBP10_DANRE (Ran-binding protein 10 OS=Danio rerio GN=ranbp10 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.256e-18
Identity = 44/120 (36.67%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            ++ +S + L V Y     +  D   V+A  P P    +YYFE+ +   G  G + IG +++   M R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:   53 YIGLSQNNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTK 172          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RANB9_MOUSE (Ran-binding protein 9 OS=Mus musculus GN=Ranbp9 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.253e-18
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            ++ +S + L V Y        D   V+A  P P    +YYFE+ +   G  G + IG +++   M R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:  102 YIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTK 221          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RANB9_HUMAN (Ran-binding protein 9 OS=Homo sapiens GN=RANBP9 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.253e-18
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            ++ +S + L V Y        D   V+A  P P    +YYFE+ +   G  G + IG +++   M R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:  177 YIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTK 296          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RANB9_DANRE (Ran-binding protein 9 OS=Danio rerio GN=ranbp9 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.253e-18
Identity = 45/120 (37.50%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            ++ +S + L V Y        D   V+A  P P    VYYFE+ +   G  G + IG +++   M R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:   59 YIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGVYYFEVKIISKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTK 178          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RBP10_MOUSE (Ran-binding protein 10 OS=Mus musculus GN=Ranbp10 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.472e-18
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            ++ +S   L V Y     +  D   V+A  P P    +YYFE+ +   G  G + IG +++   M R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:   93 YIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTK 212          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RBP10_HUMAN (Ran-binding protein 10 OS=Homo sapiens GN=RANBP10 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.472e-18
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            ++ +S   L V Y     +  D   V+A  P P    +YYFE+ +   G  G + IG +++   M R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:   65 YIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTK 184          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RBP10_BOVIN (Ran-binding protein 10 OS=Bos taurus GN=RANBP10 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.472e-18
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            ++ +S   L V Y     +  D   V+A  P P    +YYFE+ +   G  G + IG +++   M R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:   65 YIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTK 184          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RANB9_XENLA (Ran-binding protein 9 OS=Xenopus laevis GN=ranbp9 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.368e-16
Identity = 42/120 (35.00%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            +L +S   L V Y        D   V++  P P    ++YFE+ +   G  G + IG +++   + R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:   32 YLGLSHGNLRVHYKGHGKTSKDAASVRSTHPIPAACGIFYFEVKIISKGRDGYMGIGLSTQGVNLNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLIDNTCFYTK 151          
BLAST of DC900097 vs. ExPASy Swiss-Prot
Match: RANB9_XENTR (Ran-binding protein 9 OS=Xenopus tropicalis GN=ranbp9 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.786e-16
Identity = 42/120 (35.00%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  234 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHGDDGLLYRGQGKGEAFGPTFTTNDTVGGGINYAYRN-FFTK 590
            +L +S   L V Y        D   V++  P P    ++YFE+ +   G  G + IG +++   + R PGW+ +S GYHGDDG  +   G G+ +GPTFTT D +G  +N      F+TK
Sbjct:   32 YLGLSHGNLRVHYKGHGKTSKDAASVRSTHPIPAACGIFYFEVKIISKGRDGYMGIGLSTQGVNLSRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLIDNTCFYTK 151          
The following BLAST results are available for this feature:
BLAST of DC900097 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
RBP9X_DROME5.933e-2039.32Ran-binding proteins 9/10 homolog OS=Drosophila me... [more]
RBP10_DANRE3.256e-1836.67Ran-binding protein 10 OS=Danio rerio GN=ranbp10 P... [more]
RANB9_MOUSE7.253e-1836.67Ran-binding protein 9 OS=Mus musculus GN=Ranbp9 PE... [more]
RANB9_HUMAN7.253e-1836.67Ran-binding protein 9 OS=Homo sapiens GN=RANBP9 PE... [more]
RANB9_DANRE7.253e-1837.50Ran-binding protein 9 OS=Danio rerio GN=ranbp9 PE=... [more]
RBP10_MOUSE9.472e-1836.67Ran-binding protein 10 OS=Mus musculus GN=Ranbp10 ... [more]
RBP10_HUMAN9.472e-1836.67Ran-binding protein 10 OS=Homo sapiens GN=RANBP10 ... [more]
RBP10_BOVIN9.472e-1836.67Ran-binding protein 10 OS=Bos taurus GN=RANBP10 PE... [more]
RANB9_XENLA1.368e-1635.00Ran-binding protein 9 OS=Xenopus laevis GN=ranbp9 ... [more]
RANB9_XENTR1.786e-1635.00Ran-binding protein 9 OS=Xenopus tropicalis GN=ran... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900097 VSS Citrus sinensis cDNA clone VS27V13 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900097 ID=DC900097|Name=DC900097|organism=Citrus sinensis|type=EST|length=708bp
GAACTCTCCTGCTCATGTATGATTCTTTGAAACAAGTGTAGGGTTTCACT
TTATGCCAATTCCAAACAATGAGCACAAACAACACTAACAACATTAAAAA
TGAAGATCTCGGCTTGCACTTCCTCGCGCTGGCCCGGGCTTCTTCGAGCT
CGATGGGCGGAAAGCGGGAGGAGGAGGATTTTGAGGAAGAAGAGGTGCCG
ACGGAGCTGAACACGATCAACAGCTCTGGAGGGTTCCTGGTGGTTTCGCC
GGATAAGTTGTCGGTCAAGTACACTAGCGTCAATCTGCACGGCCATGATG
TCGGCGTCGTCCAAGCTAACAAGCCGGCTCCTGTTAAGCGGCTTGTTTAT
TACTTTGAGATTTACGTGGAGGACGCTGGTGCCAAGGGCCAGATTGCCAT
TGGATTTACCAGTGAGTCTTTCAAGATGCGGAGGCAACCAGGGTGGGAAG
CGAACAGTTGTGGATACCATGGGGATGATGGATTGCTTTATCGTGGACAA
GGAAAGGGAGAGGCCTTTGGCCCTACGTTTACAACTAATGATACTGTTGG
TGGTGGTATTAACTATGCTTACAGGAATTTTTTTACTAAATGGTCATTAG
TAGAGCAGNGTCAAGACTCAAGGTCCTTGTTCCACATTGCTGTTACAGCC
AACGAGAGGTCTGCACTCGGCAAAAAATTGTTTGTCTAGGGTCGAGCCAG
AAGGTGAG
back to top