DC900095

Overview
NameDC900095
Unique NameDC900095
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length886
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900095 vs. ExPASy Swiss-Prot
Match: CCC1_YEAST (Protein CCC1 OS=Saccharomyces cerevisiae GN=CCC1 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.015e-30
Identity = 72/184 (39.13%), Postives = 107/184 (58.15%), Query Frame = 1
Query:  187 IVRDVIIGVSDGLTVPFALAAGLSGANATSSIVLTAGIAEVAAGAISMGLGGYLAAKSEADHYARELKREQEEIITVPDTEAAEVAGILADY--GIEPHEYGPVVNALRKKPQAWLEFMMKFELGLEKPDPRRALHSALTIAIAYVLGGMVPLIPYMFIPRATDXXXXXXXXXXXXXXIFGYAK 732
            ++ D+IIG+SDGLTVPFAL AGLS     + +V+T G AE+ +GAISMGLGGYL AKSE+D+Y  E+K+E+ +     +    E+  IL +             +  L++ P+  ++F++++  GL++P   R L SA+TI   Y+LGG+VPL+PY F+                    FGY K
Sbjct:  100 VISDLIIGLSDGLTVPFALTAGLSSLG-DAKLVITGGFAELISGAISMGLGGYLGAKSESDYYHAEVKKEKRKFYDNSNLINREIEDILLEINPNFSDETIVSFIKDLQRTPELMVDFIIRYGRGLDEPAENRELISAVTIGGGYLLGGLVPLVPYFFVSDVGTGLIYSIIVMVVTLFWFGYVK 282          
BLAST of DC900095 vs. ExPASy Swiss-Prot
Match: PCL1_SCHPO (Fe(2+)/Mn(2+) transporter pcl1 OS=Schizosaccharomyces pombe GN=pcl1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.507e-11
Identity = 45/157 (28.66%), Postives = 81/157 (51.59%), Query Frame = 1
Query:  190 VRDVIIGVSDGLTVPFALAAGLSGANATSSIVLTAGIAEVAAGAISMGLGGYLAAKSEADHYARELKREQEEIITVPDTEAAEVAGILADYGIEPHEYGPVVNALRKKPQAWLEFMMKFELGLEKPDPRRALHSALTIAIAYVLGGMVPLIPYMFIP 660
            +R  ++G +DG+     L  G+  ANA   ++L  G+A + +GA+SM +G Y++  S+AD    +L+ E+ E+    D E  E+A I    G++      V  A++      LE   + ELG+      +   +AL+ A ++ +GG+ PL+  +  P
Sbjct:   21 LRASVLGANDGILSLSGLLVGVVAANADIKVILITGVAGLMSGALSMAVGEYVSVSSQADLEDADLQLERREMDADWDAEVDELAAIYRGRGLDEELSRTV--AVQLMEYNALEAHARDELGINIHTTAKPTLAALSSAASFSVGGIFPLLTSLITP 175          
The following BLAST results are available for this feature:
BLAST of DC900095 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
CCC1_YEAST7.015e-3039.13Protein CCC1 OS=Saccharomyces cerevisiae GN=CCC1 P... [more]
PCL1_SCHPO2.507e-1128.66Fe(2+)/Mn(2+) transporter pcl1 OS=Schizosaccharomy... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900095 VSS Citrus sinensis cDNA clone VS27V11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900095 ID=DC900095|Name=DC900095|organism=Citrus sinensis|type=EST|length=886bp
CAATAATCATAAGTTAACGCCCCCAAAAATCCTCTTCTTTTTCTTTTAAT
TATTCTATACTATACTCACATATAAATCCAACCATCTCTCTGAAATCAAC
TCAATTCAATTCAAATGGCAAACATAGAGCCGGAGAAGCAGACCCTTCTC
AACCAGCACAGAGAGAAACACTTCACCGCCGGCGAGATCGTGCGCGACGT
GATCATCGGGGTATCCGACGGTCTCACCGTGCCCTTTGCCCTCGCTGCCG
GGTTATCCGGAGCCAATGCCACGTCGTCCATCGTCCTCACCGCTGGCATC
GCCGAGGTGGCCGCCGGCGCCATTTCCATGGGACTCGGCGGGTATCTGGC
GGCTAAGAGTGAAGCTGATCATTATGCCAGGGAGTTGAAAAGAGAGCAAG
AAGAGATCATCACTGTTCCTGATACAGAAGCGGCTGAAGTGGCGGGGATA
CTGGCGGACTATGGGATAGAGCCACATGAATACGGACCTGTTGTTAATGC
TCTAAGGAAGAAGCCTCAAGCTTGGCTTGAATTTATGATGAAGTTTGAAT
TGGGATTGGAGAAGCCAGATCCAAGAAGAGCATTGCATAGCGCACTAACC
ATCGCAATTGCTTATGTGTTGGGGGGAATGGTACCCCTTATTCCTTACAT
GTTCATTCCCAGAGCTACCGATGCCGTGCTTGCATCAGTCGCTGTAACCT
TGGTGGCATTGCTGATTTTTGGCTATGCCAAGGGTTACTTCACAGGAAAT
AAACCTGTCAAAAGTGCGCTCCAAACTGCCTTCATCGGAGCCATTGCATC
CGCTGCTGCTTTTGGCATGGCCAAGGCCGTAGCTTAAAAACGTGTTGTTT
ATGTAATATTTCCTACCTGCAAATTTGTGTTGTTTT
back to top