DC900094

Overview
NameDC900094
Unique NameDC900094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length552
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900094_ssr357 microsatellite DC900094_ssr357:357..366. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13712 contig Csv1_Contig13712:294..845. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA26_ARATH (Bifunctional purple acid phosphatase 26 OS=Arabidopsis thaliana GN=PAP26 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.161e-45
Identity = 61/70 (87.14%), Postives = 64/70 (91.43%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYWASNRRRRKLNKHYLRSVVG 316
            PQPDYSAFREASYGHSTL+IKNRTHA YHWNRNDDGKKVATD F+LHNQYW  N RRRKL KHY+RSVVG
Sbjct:  401 PQPDYSAFREASYGHSTLDIKNRTHAIYHWNRNDDGKKVATDEFVLHNQYWGKNIRRRKLKKHYIRSVVG 470          

HSP 2 Score: 66.6254 bits (161), Expect = 1.161e-45
Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPD 104
            DV+FAGHVHAYERSYRISN+ YN+SSGD +PVPD
Sbjct:  343 DVIFAGHVHAYERSYRISNVRYNVSSGDRYPVPD 376          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA12_ARATH (Fe(3+)-Zn(2+) purple acid phosphatase 12 OS=Arabidopsis thaliana GN=PAP12 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.845e-25
Identity = 35/56 (62.50%), Postives = 43/56 (76.79%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYWASNRR 274
            PQP YSAFREAS+GH  LEIKNRTHA++ WNRN DG  VA DS  L N++W + ++
Sbjct:  408 PQPKYSAFREASFGHGLLEIKNRTHAYFSWNRNQDGNAVAADSVWLLNRFWRAQKK 463          

HSP 2 Score: 55.0694 bits (131), Expect = 1.845e-25
Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPDIHSQIIL 125
            DVVFAGHVHAYERS R+SN+ YNI +G C P+ D  + I +
Sbjct:  350 DVVFAGHVHAYERSERVSNIAYNIVNGLCEPISDESAPIYI 390          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPAF2_IPOBA (Purple acid phosphatase 2 OS=Ipomoea batatas GN=PAP2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.347e-24
Identity = 33/51 (64.71%), Postives = 42/51 (82.35%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP+YSAFREAS+GH+TL+IKNRTHA+Y W+RN DG  V  DS  + N++W
Sbjct:  404 PQPEYSAFREASFGHATLDIKNRTHAYYSWHRNQDGYAVEADSMWVSNRFW 454          

HSP 2 Score: 52.7582 bits (125), Expect = 3.347e-24
Identity = 23/34 (67.65%), Postives = 28/34 (82.35%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPD 104
            D+VFAGHVHAYERS R+SN+ Y+I +G C PV D
Sbjct:  346 DLVFAGHVHAYERSERVSNVAYDIVNGKCTPVRD 379          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPAF1_IPOBA (Purple acid phosphatase 1 OS=Ipomoea batatas GN=PAP1 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.657e-23
Identity = 34/53 (64.15%), Postives = 39/53 (73.58%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYWAS 265
            PQP YSAFREAS+GH   +IKNRTHA + W+RN DG  V  DS  L N+YWAS
Sbjct:  412 PQPSYSAFREASFGHGIFDIKNRTHAHFSWHRNQDGASVEADSLWLLNRYWAS 464          

HSP 2 Score: 51.2174 bits (121), Expect = 4.657e-23
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPD 104
            D+VF+GHVH+YERS R+SN+ YNI +  C PV D
Sbjct:  354 DIVFSGHVHSYERSERVSNVAYNIVNAKCTPVSD 387          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA25_ARATH (Purple acid phosphatase 25 OS=Arabidopsis thaliana GN=PAP25 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 6.061e-23
Identity = 33/51 (64.71%), Postives = 42/51 (82.35%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP YSA+REAS+GH+ LEI NRTHA+Y W+RN D + VA DS +LHN+Y+
Sbjct:  403 PQPSYSAYREASFGHAVLEIYNRTHAYYTWHRNQDNEPVAADSIMLHNRYF 453          

HSP 2 Score: 49.6766 bits (117), Expect = 6.061e-23
Identity = 21/41 (51.22%), Postives = 31/41 (75.61%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPDIHSQIIL 125
            D+V +GHVH+YERS R+SN+ YNI++G  +PV D  + I +
Sbjct:  345 DLVLSGHVHSYERSERVSNIKYNITNGLSYPVKDPSAPIYI 385          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA11_ARATH (Purple acid phosphatase 11 OS=Arabidopsis thaliana GN=PAP11 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.336e-22
Identity = 31/51 (60.78%), Postives = 38/51 (74.51%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP YSAFREAS+GH+ LEIKNRTHA Y W+RN + + V  DS  L  +Y+
Sbjct:  384 PQPSYSAFREASFGHALLEIKNRTHAHYTWHRNKEDEAVIADSIWLKKRYY 434          

HSP 2 Score: 57.7658 bits (138), Expect = 1.336e-22
Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPDIHSQIIL 125
            D+VFAGHVHAYERS RISN+HYNI+ G   PV D ++ I +
Sbjct:  326 DIVFAGHVHAYERSKRISNIHYNITDGMSTPVKDQNAPIYI 366          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPAF_PHAVU (Fe(3+)-Zn(2+) purple acid phosphatase OS=Phaseolus vulgaris PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 1.337e-22
Identity = 31/51 (60.78%), Postives = 37/51 (72.55%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP+YSAFREAS+GH   +IKNRTHA + WNRN DG  V  DS    N++W
Sbjct:  375 PQPEYSAFREASFGHGMFDIKNRTHAHFSWNRNQDGVAVEADSVWFFNRHW 425          

HSP 2 Score: 53.9138 bits (128), Expect = 1.337e-22
Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPD 104
            DVVFAGHVHAYERS R+SN+ Y I+ G C PV D
Sbjct:  317 DVVFAGHVHAYERSERVSNIAYKITDGLCTPVKD 350          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPAF_SOYBN (Purple acid phosphatase OS=Glycine max GN=PAP PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.940e-22
Identity = 31/51 (60.78%), Postives = 36/51 (70.59%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP YSAFREAS+GH+  +I NRTHA Y W+RN DG  V  DS    N+YW
Sbjct:  402 PQPKYSAFREASFGHAIFDITNRTHAHYSWHRNQDGVAVEADSLWSFNRYW 452          

HSP 2 Score: 54.6842 bits (130), Expect = 2.940e-22
Identity = 25/34 (73.53%), Postives = 28/34 (82.35%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPD 104
            DVVFAGHVHAYERS R+SN+ YNI +G C PV D
Sbjct:  344 DVVFAGHVHAYERSERVSNVAYNIVNGLCAPVND 377          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA5_ARATH (Purple acid phosphatase 5 OS=Arabidopsis thaliana GN=PAP5 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.838e-22
Identity = 32/51 (62.75%), Postives = 39/51 (76.47%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP YSAFREAS+GH+ LEIKNRTHA Y W+RN + + V  DS  L N+Y+
Sbjct:  339 PQPSYSAFREASFGHALLEIKNRTHAHYTWHRNKEDEAVIADSIWLKNRYY 389          

HSP 2 Score: 53.9138 bits (128), Expect = 3.838e-22
Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPDIHSQIIL 125
            D+VFAGHVHAYERS R+SN+ YNI+ G   PV D ++ + +
Sbjct:  281 DIVFAGHVHAYERSERVSNIQYNITDGMSTPVKDQNAPVYI 321          
BLAST of DC900094 vs. ExPASy Swiss-Prot
Match: PPA10_ARATH (Purple acid phosphatase 10 OS=Arabidopsis thaliana GN=PAP10 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.976e-22
Identity = 30/51 (58.82%), Postives = 36/51 (70.59%), Query Frame = 2
Query:  107 PQPDYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKKVATDSFILHNQYW 259
            PQP YSAFREAS+GH+   IKNRTHA Y W+RN DG  V  D    +N++W
Sbjct:  407 PQPKYSAFREASFGHAIFSIKNRTHAHYGWHRNHDGYAVEGDRMWFYNRFW 457          

HSP 2 Score: 55.4546 bits (132), Expect = 4.976e-22
Identity = 24/34 (70.59%), Postives = 28/34 (82.35%), Query Frame = 3
Query:    3 DVVFAGHVHAYERSYRISNLHYNISSGDCFPVPD 104
            DVVFAGHVHAYERS R+SN+ YN+ +G C PV D
Sbjct:  349 DVVFAGHVHAYERSERVSNIAYNVVNGICTPVKD 382          
The following BLAST results are available for this feature:
BLAST of DC900094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
PPA26_ARATH1.161e-4587.14Bifunctional purple acid phosphatase 26 OS=Arabido... [more]
PPA12_ARATH1.845e-2562.50Fe(3+)-Zn(2+) purple acid phosphatase 12 OS=Arabid... [more]
PPAF2_IPOBA3.347e-2464.71Purple acid phosphatase 2 OS=Ipomoea batatas GN=PA... [more]
PPAF1_IPOBA4.657e-2364.15Purple acid phosphatase 1 OS=Ipomoea batatas GN=PA... [more]
PPA25_ARATH6.061e-2364.71Purple acid phosphatase 25 OS=Arabidopsis thaliana... [more]
PPA11_ARATH1.336e-2260.78Purple acid phosphatase 11 OS=Arabidopsis thaliana... [more]
PPAF_PHAVU1.337e-2260.78Fe(3+)-Zn(2+) purple acid phosphatase OS=Phaseolus... [more]
PPAF_SOYBN2.940e-2260.78Purple acid phosphatase OS=Glycine max GN=PAP PE=1... [more]
PPA5_ARATH3.838e-2262.75Purple acid phosphatase 5 OS=Arabidopsis thaliana ... [more]
PPA10_ARATH4.976e-2258.82Purple acid phosphatase 10 OS=Arabidopsis thaliana... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900094 VSS Citrus sinensis cDNA clone VS27V10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900094 ID=DC900094|Name=DC900094|organism=Citrus sinensis|type=EST|length=552bp
TTGATGTTGTCTTTGCTGGCCATGTCCATGCTTATGAAAGATCGTATCGA
ATCTCGAATCTACACTACAACATATCAAGTGGTGACTGTTTCCCTGTGCC
AGATATCCACAGCCAGATTATTCTGCCTTTCGAGAAGCCAGTTATGGGCA
CTCTACACTAGAGATTAAAAACAGGACACATGCATTCTACCACTGGAACC
GCAATGATGATGGGAAAAAAGTGGCAACGGACTCATTCATATTGCACAAT
CAGTACTGGGCAAGCAACCGTAGGAGGAGAAAACTGAACAAGCACTATTT
AAGAAGCGTTGTTGGCGAGCTTTTTGCTTAACTAGGAGGTATCTAGAGAG
TCTCCGATATATATATGGTCGATTGGATACAAACTCACGGGGGATTTCAG
TCAAATTCTTCAACTTGTATGATTACGCCGCATACAATTCATCCCTTATT
TGTCATGTTGTAGACCTGTAGTATATTTCAATAAGAATCAATATGTTGTA
ACAATATTTGCAAGCTACATTGACATATATGGAGAAATGCCACGTTACAT
AT
back to top