DC900092

Overview
NameDC900092
Unique NameDC900092
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length707
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2880 contig Csv1_Contig2880:368..1074. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 446.817 bits (1148), Expect = 5.207e-125
Identity = 218/228 (95.61%), Postives = 223/228 (97.81%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIP 686
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFN KN +VKDLKRGYVASNS+  P
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDP 321          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 8.881e-125
Identity = 217/231 (93.94%), Postives = 224/231 (96.97%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIPPGG 695
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFN KN +VKDLKRGYVASNS+  P  G
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKG 324          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 8.881e-125
Identity = 218/236 (92.37%), Postives = 227/236 (96.19%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIP-PGGIHFT 707
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM+VTF P+GLTTEVKSVEMHHESLLEALPGDNVGFN KN +VKDLKRGYVASNS+  P  G  +FT
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFT 329          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 1.979e-124
Identity = 215/228 (94.30%), Postives = 224/228 (98.25%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIP 686
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EIVKEVSSYLKKVGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMHHESLLEALPGDNVGFN KN +VKDLKRG+VASNS+  P
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDP 321          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 9.820e-124
Identity = 216/231 (93.51%), Postives = 222/231 (96.10%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIPPGG 695
            GHRDFIKNMITGTSQADCAVLIID TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALDQINEPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGM+VTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFN KN SVKDLKRGYVASNS+  P  G
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDPTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKPGMVVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKG 324          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A2_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.675e-123
Identity = 213/228 (93.42%), Postives = 223/228 (97.81%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIP 686
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVK MICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGYNPDK+PFVPISGFEGDNMIERS+NLDWYKGPTLLEALDQINEPKRP++KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMHHESLLEALPGDNVGFN KN +VKDLKRGYVASNS+  P
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKHMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDQINEPKRPSEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDP 321          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 2.857e-123
Identity = 215/231 (93.07%), Postives = 223/231 (96.54%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIPPGG 695
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIN+ KRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFN KN +VKDLKRG+VASNS+  P  G
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKG 324          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 6.365e-123
Identity = 214/228 (93.86%), Postives = 221/228 (96.93%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIP 686
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGM+VTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFN KN +VKDLKRG VASNS+  P
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGIVASNSKDDP 321          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 437.958 bits (1125), Expect = 2.419e-122
Identity = 213/228 (93.42%), Postives = 221/228 (96.93%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIP 686
            GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDQI+EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTF P+GLTTEVKSVEMHHESL EA PGDNVGFN KN +VKDLKRGYVASNS+  P
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDP 321          
BLAST of DC900092 vs. ExPASy Swiss-Prot
Match: EF1A1_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 4.126e-122
Identity = 211/228 (92.54%), Postives = 222/228 (97.37%), Query Frame = 3
Query:    3 GHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMIVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNXKNXSVKDLKRGYVASNSRMIP 686
            GHRDFIKNMITGTSQADCAVLIIDSTTG F+AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGYNPDK+PFVPISGFEGDNMIERS+NLDWYKGPTLLEALDQINEPKRP+DKPL LPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVE+HHESLLEALPGDNVGFN KN +VKDLKRGYVASNS+  P
Sbjct:   94 GHRDFIKNMITGTSQADCAVLIIDSTTGVFQAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDQINEPKRPSDKPLHLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEVHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDP 321          
The following BLAST results are available for this feature:
BLAST of DC900092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ5.207e-12595.61Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_SOLLC8.881e-12593.94Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_ARATH8.881e-12592.37Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_WHEAT1.979e-12494.30Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A1_DAUCA9.820e-12493.51Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]
EF1A2_HORVU1.675e-12393.42Elongation factor 1-alpha OS=Hordeum vulgare GN=BL... [more]
EF1A_TOBAC2.857e-12393.07Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_MANES6.365e-12393.86Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_SOYBN2.419e-12293.42Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A1_HORVU4.126e-12292.54Elongation factor 1-alpha OS=Hordeum vulgare PE=1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900092 VSS Citrus sinensis cDNA clone VS27V08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900092 ID=DC900092|Name=DC900092|organism=Citrus sinensis|type=EST|length=707bp
CTGGACATCGTGACTTTATTAAGAACATGATTACTGGTACTTCTCAGGCT
GATTGTGCTGTCCTTATCATCGACTCCACCACTGGTGGTTTTGAAGCTGG
TATCTCTAAGGATGGGCAGACCAGAGAGCACGCTCTACTTGCTTTCACCC
TTGGTGTGAAGCAAATGATTTGTTGCTGTAACAAGATGGATGCCACCACT
CCCAAGTATTCAAAGGCAAGATATGATGAAATTGTTAAGGAAGTCTCTTC
CTACTTGAAGAAGGTTGGCTACAACCCAGATAAGATTCCATTTGTCCCAA
TCTCTGGATTTGAGGGTGATAACATGATTGAGAGGTCCACAAACCTTGAC
TGGTACAAGGGCCCAACCCTTCTTGAAGCTCTTGACCAGATCAATGAACC
CAAGAGACCAACAGACAAGCCTCTCCGTCTCCCCCTTCAGGATGTCTACA
AGATTGGTGGTATTGGAACTGTCCCTGTTGGCCGTGTTGAAACTGGTGTA
CTCAAGCCCGGTATGATAGTCACATTCGGTCCATCTGGATTGACTACTGA
AGTTAAGTCAGTTGAGATGCACCATGAGTCTCTCCTGGAGGCACTTCCTG
GTGATAATGTGGGGTTCAACGNTAAGAATGNTTCAGTGAAGGATCTTAAG
CGTGGGTACGTTGCATCTAACTCCAGGATGATCCCGCCAGGGGGCATCCA
CTTCACC
back to top