CN185920

Overview
NameCN185920
Unique NameCN185920
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length628
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2259 contig Csv1_Contig2259:40..667. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185920 vs. ExPASy Swiss-Prot
Match: WUN1_SOLTU (Wound-induced protein 1 OS=Solanum tuberosum GN=WUN1 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 5.583e-29
Identity = 67/107 (62.62%), Postives = 75/107 (70.09%), Query Frame = 1
Query:  298 FVFVPLSITSFGPIVLAEGCDHSRQISWVHAWTVADGIITQVREYFNTSLTVTRFGKDLSGQSQRKKSPPSDFPSTAEINPVHCPSVWESSVSNRDGKSVPGLVLAL 618
            F F+  +I  FG +VL EGCD +R I+WVHAWTV DG+ITQVREYFNTSLTVTRFGK             SD  S   I  +HCPSVWESS+ NR GKSVPGLVLAL
Sbjct:   15 FQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVTDGVITQVREYFNTSLTVTRFGK-------------SDISS---ITTLHCPSVWESSLPNRVGKSVPGLVLAL 105          
The following BLAST results are available for this feature:
BLAST of CN185920 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
WUN1_SOLTU5.583e-2962.62Wound-induced protein 1 OS=Solanum tuberosum GN=WU... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002B02_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185920 ID=CN185920|Name=CN185920|organism=Citrus sinensis|type=EST|length=628bp
AGTTACAAAACAAATTCATTTCATCTTCAGTTTCTCTGTTCTTGTTGTTG
CCATTTTTTAAGGCTATTCCGTCAAGAACTGGCTAACTCTCAGCAGAAAA
ATCCGGAAGATTCCGAAAACAAGAACCAGCGCGTGGTTCTTGCTCTGTAT
GATGCCTTAAAATCTCGAGACGTTGAAACGGTACACAAGATCCTTGCCCC
GGACCTAGAGTGGTGGTTCCATGGCCCGCCGACCCACCAGTTTATGATGC
ACCTTCTCACCGGCAGCACCACCGCATCGTCAGCATCGCAAAGCTCCTTC
GTATTCGTTCCTCTCTCGATCACATCGTTCGGGCCCATTGTCCTCGCCGA
GGGCTGTGATCACAGCCGTCAAATCAGCTGGGTCCACGCCTGGACGGTCG
CTGATGGGATAATTACTCAAGTCAGAGAATACTTCAACACTTCGCTTACC
GTCACCCGCTTCGGTAAAGACTTGTCTGGCCAAAGTCAGAGGAAGAAATC
ACCACCCTCTGATTTCCCATCAACAGCGGAGATTAATCCGGTGCATTGCC
CCTCCGTTTGGGAGAGCAGCGTCTCCAACCGGGACGGTAAATCTGTCCCG
GGTTTGGTTCTCGCTCTCTAAGCAAACC
back to top