DC900090

Overview
NameDC900090
Unique NameDC900090
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1120
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3317 contig Csv1_Contig3317:191..1310. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: AI5L2_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 2 OS=Arabidopsis thaliana GN=DPBF3 PE=1 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.483e-41
Identity = 110/244 (45.08%), Postives = 135/244 (55.33%), Query Frame = 2
Query:    2 NSWYSLTLNEVENQLGNLGKPLGSMNLDELLKSVWSTEANDSTGIDIENSSTASSSLQRQASLTLARALSGKTVEQVWNEIQQGQKKRYGQEMKSHQREPTLGEMTLEDFLVQAGLFAEASVSPMDLDTVG----------------------VVTMQSFPEKMSLSP------------SSSIG----TLTPRRKR--DDNAFEKSIERRLRRKIKNRESAARSRARKQAYHNELVSKVSRLE 613
            +S YSLTL+EV+N LG+ GK LGSMNLDELLKSV S EAN  + + +   + A   L RQ SLTL R LS KTV++VW +IQ  Q K  G   +   ++PTLGEMTLED L++AG+  E          VG                         + S P+  +  P            SS +G    T TP RKR       EK++ERR +R IKNRESAARSRARKQAY +EL  KVSRLE
Sbjct:   20 SSLYSLTLDEVQNHLGSSGKALGSMNLDELLKSVCSVEANQPSSMAVNGGAAAQEGLSRQGSLTLPRDLSKKTVDEVWKDIQ--QNKNGGSAHERRDKQPTLGEMTLEDLLLKAGVVTETIPGSNHDGPVGGGSAGSGAGLGQNITQVGPWIQYHQLPSMPQPQAFMPYPVSDMQAMVSQSSLMGGLSDTQTPGRKRVASGEVVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLE 261          

HSP 2 Score: 25.7942 bits (55), Expect = 1.483e-41
Identity = 13/22 (59.09%), Postives = 15/22 (68.18%), Query Frame = 3
Query:  657 MLPSDSLQEPKYQLRRMSSASF 722
            +LPS    +PK QLRR SSA F
Sbjct:  276 ILPSVPPPDPKRQLRRTSSAPF 297          
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: AI5L3_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 3 OS=Arabidopsis thaliana GN=DPBF4 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.834e-35
Identity = 100/227 (44.05%), Postives = 122/227 (53.74%), Query Frame = 2
Query:    2 NSWYSLTLNEVENQLGNLGKPLGSMNLDELLKSVWSTEANDSTGIDIENSSTASSSLQRQASLTLARALSGKTVEQVWNEIQQGQKKRYGQEMKSHQREPTLGEMTLEDFLVQAGLFAEASVSPMDLDTVG----------------------VVTMQSFPEKMSLSPSSSIGTLTPRRKR-DDNAFEKSIERRLRRKIKNRESAARSRARKQAYHNELVSKVSRLE 613
            NS YSL L+EV+  LG+ GKPLGSMNLDELLK+V                  A   L RQ SLTL R LS KTV++VW +IQQ  K   G    +  ++PTLGE+TLED L++AG+  E  V   ++  +                       V  MQ       LS +       P RKR      EK++ERR +R IKNRESAARSRARKQAY +EL  KVSRLE
Sbjct:   20 NSLYSLKLHEVQTHLGSSGKPLGSMNLDELLKTVLPP---------------AEEGLVRQGSLTLPRDLSKKTVDEVWRDIQQ-DKNGNGTSTTTTHKQPTLGEITLEDLLLRAGVVTETVVPQENVVNIASNGQWVEYHHQPQQQQGFMTYPVCEMQDMVMMGGLSDTPQ----APGRKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLE 226          

HSP 2 Score: 26.1794 bits (56), Expect = 6.834e-35
Identity = 11/21 (52.38%), Postives = 17/21 (80.95%), Query Frame = 3
Query:  657 MLPSDSLQEPKYQLRRMSSAS 719
            +LPS+   +PK++LRR +SAS
Sbjct:  241 ILPSEPPPDPKWKLRRTNSAS 261          
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: AI5L1_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 1 OS=Arabidopsis thaliana GN=DPBF2 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.724e-24
Identity = 93/256 (36.33%), Postives = 130/256 (50.78%), Query Frame = 2
Query:    2 NSWYSLTLNEVENQLGNLGKPLGSMNLDELLKSVWST-EANDSTGIDIENSSTASSSLQRQASLTLARALSGKTVEQVWNEIQQGQKK-----RYGQEMKSH-QREPTLGEMTLEDFLVQAGLFAEASVSPMDLDT----------VGV-------------VTMQSFPEKMSLSPSSSIGTLTPR--------------RKRDDNAFEKSIERRLRRKIKNRESAARSRARKQAYHNELVSKVSRLERGKFEAQE 637
            NS  SLTL+E++ + G   K  G+MN+DE L ++W+T E ND+ G    N     + L RQ SL+L   L  KTV++VW EIQ G ++       GQ    + +R+ TLGE+TLEDFLV+AG+  E   + M + +          VG+             V  ++ P    L  SSS  T   R              ++  D   E  +ERR RR IKNRESAARSRAR+QAY  EL  +++ L     + +E
Sbjct:   39 NSILSLTLDEIQMKSG---KSFGAMNMDEFLANLWTTVEENDNEGGGAHNDGEKPAVLPRQGSLSLPVPLCKKTVDEVWLEIQNGVQQHPPSSNSGQNSAENIRRQQTLGEITLEDFLVKAGVVQEPLKTTMRMSSSDFGYNPEFGVGLHCQNQNNYGDNRSVYSENRPFYSVLGESSSCMTGNGRSNQYLTGLDAFRIKKRIIDGPPEILMERRQRRMIKNRESAARSRARRQAYTVELELELNNLTEENTKLKE 291          
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: AI5L4_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 4 OS=Arabidopsis thaliana GN=ABF1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 7.060e-20
Identity = 56/129 (43.41%), Postives = 78/129 (60.47%), Query Frame = 2
Query:    2 NSWYSLTLNEVENQLGNLGKPLGSMNLDELLKSVWSTEANDSTGIDIENSSTAS----------SSLQRQASLTLARALSGKTVEQVWNEIQQGQKKRYGQEMKSHQREPTLGEMTLEDFLVQAGLFAE 358
            +S YSLT +E+++ LG  GK  GSMN+DELLK++W+ E  D+       SS A+          + LQRQ SLTL R LS KTV++VW  +   +         + +R+ TLGEMTLEDFL++AG+  E
Sbjct:   27 SSLYSLTFDELQSTLGEPGKDFGSMNMDELLKNIWTAE--DTQAFMTTTSSVAAPGPSGFVPGGNGLQRQGSLTLPRTLSQKTVDEVWKYLNSKEGSNGNTGTDALERQQTLGEMTLEDFLLRAGVVKE 153          
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: AI5L7_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 7 OS=Arabidopsis thaliana GN=ABF4 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.806e-19
Identity = 56/136 (41.18%), Postives = 78/136 (57.35%), Query Frame = 2
Query:    2 NSWYSLTLNEVENQLGNLGKPLGSMNLDELLKSVWSTEANDSTGIDIENSSTA-----------SSSLQRQASLTLARALSGKTVEQVWNEI------QQGQKKRYGQEMKSHQREPTLGEMTLEDFLVQAGLFAE 358
            +S YSLT +E++N LG  GK  GSMN+DELLKS+W+ E   +  +    ++TA             +LQRQ SLTL R +S KTV++VW  +       +G     G+      R+ TLGEMTLE+FL +AG+  E
Sbjct:   38 SSVYSLTFDELQNTLGGPGKDFGSMNMDELLKSIWTAEEAQAMAMTSAPAATAVAQPGAGIPPPGGNLQRQGSLTLPRTISQKTVDEVWKCLITKDGNMEGSSGGGGESNVPPGRQQTLGEMTLEEFLFRAGVVRE 173          
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: AI5L5_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arabidopsis thaliana GN=ABF2 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 5.059e-18
Identity = 56/131 (42.75%), Postives = 76/131 (58.02%), Query Frame = 2
Query:    5 SWYSLTLNEVENQLGNLGKPLGSMNLDELLKSVWS---TEANDSTGIDIENSSTASSSLQRQASLTLARALSGKTVEQVWNEIQQGQKKRYG----------QEMKSHQREPTLGEMTLEDFLVQAGLFAE 358
            S YSLT +E ++   ++GK  GSMN+DELLK++WS   T+A  S  + +         LQRQ SLTL R LS KTV+QVW ++ +      G          Q     QR+ TLGE+TLE+FLV+AG+  E
Sbjct:   26 SIYSLTFDEFQS---SVGKDFGSMNMDELLKNIWSAEETQAMASGVVPVLGGGQEGLQLQRQGSLTLPRTLSQKTVDQVWKDLSKVGSSGVGGSNLSQVAQAQSQSQSQRQQTLGEVTLEEFLVRAGVVRE 153          
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: AI5L6_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 6 OS=Arabidopsis thaliana GN=ABF3 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.776e-16
Identity = 58/157 (36.94%), Postives = 82/157 (52.23%), Query Frame = 2
Query:    2 NSWYSLTLNEVENQLGN-LGKPLGSMNLDELLKSVWSTE------ANDSTGIDIENSSTASS---------------------------SLQRQASLTLARALSGKTVEQVWNEIQQ----GQKKRYGQEMKSHQREPTLGEMTLEDFLVQAGLFAE 358
            NS +SLT +E +N  G  +GK  GSMN+DELLK++W+ E       N+++  +I N ++ ++                           SLQRQ SLTL R +S K V+ VW E+ +    G     G      QR+ TLGEMTLE+FLV+AG+  E
Sbjct:   31 NSVFSLTFDEFQNSWGGGIGKDFGSMNMDELLKNIWTAEESHSMMGNNTSYTNISNGNSGNTVINGGGNNIGGLAVGVGGESGGFFTGGSLQRQGSLTLPRTISQKRVDDVWKELMKEDDIGNGVVNGGTSGIPQRQQTLGEMTLEEFLVRAGVVRE 187          
BLAST of DC900090 vs. ExPASy Swiss-Prot
Match: TRAB1_ORYSJ (bZIP transcription factor TRAB1 OS=Oryza sativa subsp. japonica GN=TRAB1 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.799e-15
Identity = 44/103 (42.72%), Postives = 64/103 (62.14%), Query Frame = 2
Query:   74 MNLDELLKSVWSTEANDSTGIDIENSSTASSSLQRQASLTLARALSGKTVEQVWNEIQQGQKKRY--------GQEMKSHQREPTLGEMTLEDFLVQAGLFAE 358
            MN+DELL+S+W+ E + +       ++ A   LQRQ SLTL R LS KTV++VW ++++              G E +  +R+PTLGEMTLE+FLV+AG+  E
Sbjct:    1 MNMDELLRSIWTAEESQAMASASAAAAAAEGGLQRQGSLTLPRTLSVKTVDEVWRDLEREASPGAAAADGGGGGGEQQQPRRQPTLGEMTLEEFLVRAGVVRE 103          
The following BLAST results are available for this feature:
BLAST of DC900090 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
AI5L2_ARATH1.483e-4145.08ABSCISIC ACID-INSENSITIVE 5-like protein 2 OS=Arab... [more]
AI5L3_ARATH6.834e-3544.05ABSCISIC ACID-INSENSITIVE 5-like protein 3 OS=Arab... [more]
AI5L1_ARATH4.724e-2436.33ABSCISIC ACID-INSENSITIVE 5-like protein 1 OS=Arab... [more]
AI5L4_ARATH7.060e-2043.41ABSCISIC ACID-INSENSITIVE 5-like protein 4 OS=Arab... [more]
AI5L7_ARATH7.806e-1941.18ABSCISIC ACID-INSENSITIVE 5-like protein 7 OS=Arab... [more]
AI5L5_ARATH5.059e-1842.75ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arab... [more]
AI5L6_ARATH2.776e-1636.94ABSCISIC ACID-INSENSITIVE 5-like protein 6 OS=Arab... [more]
TRAB1_ORYSJ1.799e-1542.72bZIP transcription factor TRAB1 OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900090 VSS Citrus sinensis cDNA clone VS27V06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900090 ID=DC900090|Name=DC900090|organism=Citrus sinensis|type=EST|length=1120bp
AAACTCGTGGTATAGTCTCACTCTCAATGAAGTTGAAAACCAGTTAGGAA
ATTTAGGGAAACCGTTGGGTAGCATGAACCTCGATGAGCTTCTTAAAAGT
GTCTGGAGCACTGAAGCAAATGATTCCACAGGGATAGACATTGAGAATTC
CTCCACAGCGTCATCTTCTCTCCAGCGTCAGGCCAGCCTGACATTGGCTA
GGGCTTTGAGTGGTAAAACGGTTGAGCAGGTCTGGAATGAAATCCAACAA
GGTCAAAAGAAGAGGTATGGGCAAGAGATGAAGAGCCATCAGAGGGAACC
TACGCTAGGAGAAATGACTTTGGAGGACTTCTTGGTACAAGCAGGGCTTT
TTGCTGAAGCATCTGTTAGTCCTATGGATTTGGACACGGTCGGGGTGGTG
ACAATGCAAAGTTTTCCCGAAAAGATGAGCTTATCACCTTCCTCTTCAAT
TGGGACATTAACACCTCGGCGGAAGAGAGATGACAATGCATTCGAGAAGA
GTATTGAAAGGAGGCTTAGGCGGAAGATAAAAAATAGGGAATCTGCTGCA
CGTTCACGAGCAAGAAAACAGGCCTATCATAATGAGCTGGTCAGCAAGGT
TTCACGATTAGAAAGAGGAAAATTTGAAGCTCAAGAAAGAGAAGGAATTT
GAGAAGATGCTGCCATCTGATTCCTTACAAGAACCAAAATATCAACTTCG
AAGAATGAGTTCAGCCTCTTTCTGATGTCAATTTACTGCTTGTTAGAGCT
AGATTGTTTGAGTATGTAAGTGGACCACTTTCTTTTGATCTTGTCATCAA
GGCTTTGTGTTGCTTCTGCTGCTGCTTCTCTTCCACCAACTGGTTGGGAA
TCGCCTTTATGTAAATTTATAATGAACTCTCTTTCTTGGAATTAAAACAG
CGCAAAATGTGCGGTGTTGATAGATAAGGTTCTGTTAGTTTGCTGGGAAA
CAAGATGGGTAAAGGATTGAGTGCATGGTGTATGCTGGGCTGCATATTGT
CAATAGGAAGCGCCCTTAAGGTCTCTCTCTTTTGGCAGTTTGAGGTTAAA
AAGTAGTGTAGTTACCCAGTTCATGTATGAATGTGCTGAAATATTATGAT
CTTAAAAGAATTAACAGCTT
back to top