DC900089

Overview
NameDC900089
Unique NameDC900089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10082 contig Csv1_Contig10082:504..1401. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PS10B_ARATH (26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=2 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 7.694e-133
Identity = 237/246 (96.34%), Postives = 243/246 (98.78%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNADFGKE 740
            SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMF YAR+HQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHA+GIAKHGEIDYEA+VKL EGFNGADLRN+CTEAGM AIRAERDYVIHEDFMKAVRKL+EAKKLESS+HYNADFGKE
Sbjct:  154 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHASGIAKHGEIDYEAIVKLGEGFNGADLRNICTEAGMFAIRAERDYVIHEDFMKAVRKLSEAKKLESSSHYNADFGKE 399          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PS10A_ARATH (26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=2 SV=1)

HSP 1 Score: 473.011 bits (1216), Expect = 1.005e-132
Identity = 237/246 (96.34%), Postives = 243/246 (98.78%), Query Frame = 3
Query:    3 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHYNADFGKE 740
            SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMF YAR+HQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFD LGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRM+ILKIHAAGIAKHGEIDYEA+VKLAEGFNGADLRN+CTEAGM AIRAERDYVIHEDFMKAVRKL+EAKKLESS+HYNADFGKE
Sbjct:  154 SIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDNLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMDILKIHAAGIAKHGEIDYEAIVKLAEGFNGADLRNICTEAGMFAIRAERDYVIHEDFMKAVRKLSEAKKLESSSHYNADFGKE 399          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_DICDI (26S protease regulatory subunit S10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 5.540e-115
Identity = 203/238 (85.29%), Postives = 220/238 (92.44%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            +ELPLM PELF+RVGIK PKGVLLYGPPGTGKTLLARAIASN++ANFLKVVSSAI+DKYIGESAR+IREMFGYARDHQPC+IFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQ+DGFD L KVK+IMATNRPDVLDPALLRPGRLDRKIEIPLPNE  R+++LKIHAA I KHG++DYEA+ KLA+GFN ADLRNVCTEAGM AIRAERDYV+ EDFMKAVRK  EAKKLE    Y
Sbjct:  153 VELPLMIPELFIRVGIKAPKGVLLYGPPGTGKTLLARAIASNLEANFLKVVSSAIVDKYIGESARVIREMFGYARDHQPCVIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLSKVKIIMATNRPDVLDPALLRPGRLDRKIEIPLPNEAGRVDVLKIHAANITKHGDVDYEAIAKLADGFNAADLRNVCTEAGMFAIRAERDYVMEEDFMKAVRKCQEAKKLEGKLDY 390          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_CAEEL (Probable 26S protease regulatory subunit S10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2)

HSP 1 Score: 402.519 bits (1033), Expect = 1.668e-111
Identity = 198/238 (83.19%), Postives = 219/238 (92.02%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            +ELPL+NPELF RVGI PPKG LL+GPPGTGKTLLARA+AS +D NFLKVVSSAI+DKYIGESAR+IREMF YARDHQPCI+FMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFD LGKVK+IMATNRPD LDPALLRPGRLDRKIEI LPNEQSR+EILKIH+  I KHGEID+EAVVKL++GF+ ADLRNVCTEAGM AIRAER++VI EDFMKAVRK+ +AK+LE+   Y
Sbjct:  166 VELPLINPELFKRVGITPPKGCLLFGPPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDY 403          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_SPETR (26S protease regulatory subunit S10B OS=Spermophilus tridecemlineatus GN=PSMC6 PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 3.716e-111
Identity = 198/238 (83.19%), Postives = 216/238 (90.76%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+I+DKYIGESARLIREMF YARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQ+DGFD L +VKMIMATNRPD LDPALLRPGRLDRKI I LPNEQ+R++ILKIHA  I KHGEIDYEA+VKL++GFNGADLRNVCTEAGM AIRA+ D+V+ EDFMKAVRK+ ++KKLES   Y
Sbjct:  149 IELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY 386          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_MOUSE (26S protease regulatory subunit S10B OS=Mus musculus GN=Psmc6 PE=1 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 3.716e-111
Identity = 198/238 (83.19%), Postives = 216/238 (90.76%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+I+DKYIGESARLIREMF YARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQ+DGFD L +VKMIMATNRPD LDPALLRPGRLDRKI I LPNEQ+R++ILKIHA  I KHGEIDYEA+VKL++GFNGADLRNVCTEAGM AIRA+ D+V+ EDFMKAVRK+ ++KKLES   Y
Sbjct:  149 IELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY 386          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_HUMAN (26S protease regulatory subunit S10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 3.716e-111
Identity = 198/238 (83.19%), Postives = 216/238 (90.76%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+I+DKYIGESARLIREMF YARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQ+DGFD L +VKMIMATNRPD LDPALLRPGRLDRKI I LPNEQ+R++ILKIHA  I KHGEIDYEA+VKL++GFNGADLRNVCTEAGM AIRA+ D+V+ EDFMKAVRK+ ++KKLES   Y
Sbjct:  149 IELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY 386          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_BOVIN (26S protease regulatory subunit S10B OS=Bos taurus GN=PSMC6 PE=2 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 2.409e-110
Identity = 197/238 (82.77%), Postives = 215/238 (90.34%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            IELPL NPELF RVGI PPKG LLYGPPGTGKTLLARA+AS +D NFLKVVSS+I+DKYIGESARLIREMF YARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQ+DGFD L +VKMIMATNRPD LDPALLRPGRLDRKI I LPNEQ+R++ILKIHA  I KHGEIDYEA+VKL++GFNGADL NVCTEAGM AIRA+ D+V+ EDFMKAVRK+ ++KKLES   Y
Sbjct:  149 IELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLGNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY 386          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_SCHPO (Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe GN=rpt4 PE=2 SV=2)

HSP 1 Score: 383.259 bits (983), Expect = 1.047e-105
Identity = 188/238 (78.99%), Postives = 210/238 (88.24%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            IELPL NPELFLRVGIKPPKGVLLYGPPGTGKTLLARA+A+++  NFLKVVSSAI+DKYIGESAR+IREMFGYA++H+PC+IFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQ+DGFD LG+ K+IMATNRPD LDPALLRPGRLDRKIEIPLPNE  RMEILKIH   ++K GEIDYEA+VKL +G NGADLRNV TEAG  AI+ +RDYVI  D M A RK+ + KKLE +  Y
Sbjct:  148 IELPLKNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAVAASLGVNFLKVVSSAIVDKYIGESARIIREMFGYAKEHEPCVIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDYLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEVGRMEILKIHLEKVSKQGEIDYEALVKLTDGTNGADLRNVVTEAGFIAIKEDRDYVIQSDLMSAARKVADLKKLEGTIDY 385          
BLAST of DC900089 vs. ExPASy Swiss-Prot
Match: PRS10_YEAST (26S protease subunit RPT4 OS=Saccharomyces cerevisiae GN=RPT4 PE=1 SV=4)

HSP 1 Score: 361.688 bits (927), Expect = 3.263e-99
Identity = 174/238 (73.11%), Postives = 203/238 (85.29%), Query Frame = 3
Query:    6 IELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKKLESSAHY 719
            IELPL NPE+F RVGIKPPKGVLLYGPPGTGKTLLA+A+A+ I ANF+   +S I+DKYIGESAR+IREMF YA++H+PCIIFMDE+DAIGGRRFSEGTSADREIQRTLMELL Q+DGFD LG+ K+IMATNRPD LDPALLRPGRLDRK+EIPLPNE  R+EI KIH A + K GE D+EA VK+++GFNGAD+RN  TEAG  AIR +RD++  +D MKAVRK+ E KKLE +  Y
Sbjct:  197 IELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEY 434          
The following BLAST results are available for this feature:
BLAST of DC900089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 389
Match NameE-valueIdentityDescription
PS10B_ARATH7.694e-13396.3426S protease regulatory subunit S10B homolog B OS=... [more]
PS10A_ARATH1.005e-13296.3426S protease regulatory subunit 10B homolog A OS=A... [more]
PRS10_DICDI5.540e-11585.2926S protease regulatory subunit S10B OS=Dictyostel... [more]
PRS10_CAEEL1.668e-11183.19Probable 26S protease regulatory subunit S10B OS=C... [more]
PRS10_SPETR3.716e-11183.1926S protease regulatory subunit S10B OS=Spermophil... [more]
PRS10_MOUSE3.716e-11183.1926S protease regulatory subunit S10B OS=Mus muscul... [more]
PRS10_HUMAN3.716e-11183.1926S protease regulatory subunit S10B OS=Homo sapie... [more]
PRS10_BOVIN2.409e-11082.7726S protease regulatory subunit S10B OS=Bos taurus... [more]
PRS10_SCHPO1.047e-10578.99Probable 26S protease subunit rpt4 OS=Schizosaccha... [more]
PRS10_YEAST3.263e-9973.1126S protease subunit RPT4 OS=Saccharomyces cerevis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900089 VSS Citrus sinensis cDNA clone VS27V05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900089 ID=DC900089|Name=DC900089|organism=Citrus sinensis|type=EST|length=899bp
AATCTATTGAGCTACCTTTGATGAATCCTGAGCTTTTCCTTAGAGTTGGA
ATTAAACCTCCCAAGGGCGTTCTTCTTTATGGGCCTCCTGGAACTGGCAA
GACATTATTAGCACGAGCAATTGCCAGTAACATAGATGCAAATTTTCTGA
AGGTTGTTTCAAGTGCCATTATTGATAAGTACATTGGGGAAAGTGCAAGG
TTGATAAGAGAGATGTTTGGATACGCACGCGATCATCAACCCTGCATCAT
TTTTATGGATGAAATTGATGCCATCGGTGGGCGCCGTTTTAGTGAAGGAA
CCAGTGCAGATCGTGAAATTCAAAGGACACTGATGGAGTTACTTAATCAG
CTTGATGGATTTGATCAGCTTGGGAAGGTTAAAATGATAATGGCCACTAA
CAGACCTGATGTCCTTGACCCTGCACTTCTTCGTCCAGGGCGACTGGATA
GGAAAATTGAGATTCCATTGCCAAATGAGCAGTCAAGAATGGAAATTCTT
AAAATTCATGCTGCTGGCATTGCTAAGCATGGCGAGATTGATTATGAGGC
TGTTGTGAAGCTTGCAGAGGGCTTTAATGGGGCTGATCTCCGAAATGTTT
GCACCGAGGCTGGAATGTCGGCAATCCGTGCTGAACGTGATTATGTCATC
CACGAAGATTTTATGAAGGCTGTCCGGAAACTGAATGAGGCAAAGAAACT
TGAATCAAGTGCTCACTACAATGCTGATTTTGGAAAAGAGTAAAAACATT
TAGGAAAAGAGCCAAGGATCTTGAGGCAGTGCGGTTATTTTTCAGATGTA
ATTGTTTTCATATTTTTGTTAAAACATCTTGCTTTAATTTGTGAAGTTAG
TGGTTCTTTGAGCGATGGAATGCTNTATATATTAAACAATCATTCACGT
back to top