CN185917
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_RICCO (Enolase OS=Ricinus communis PE=2 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 7.791e-16 Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFR PVEPY Sbjct: 406 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY 445
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_ORYSJ (Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2) HSP 1 Score: 81.6481 bits (200), Expect = 1.329e-15 Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY Sbjct: 407 GAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY 446
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO2_MAIZE (Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 2.267e-15 Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY Sbjct: 407 GAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY 446
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO2_HEVBR (Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.960e-15 Identity = 38/40 (95.00%), Postives = 38/40 (95.00%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELGAEAVYAGA FR PVEPY Sbjct: 406 GAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY 445
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_ALNGL (Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.595e-15 Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY Sbjct: 401 GAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRTPVEPY 440
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO1_MAIZE (Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.595e-15 Identity = 38/40 (95.00%), Postives = 38/40 (95.00%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELG AVYAGAKFRAPVEPY Sbjct: 407 GAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY 446
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_SOLLC (Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.614e-15 Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY Sbjct: 405 GAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY 444
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO1_HEVBR (Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.614e-15 Identity = 37/40 (92.50%), Postives = 38/40 (95.00%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY Sbjct: 406 GAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY 445
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_ARATH (Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.273e-14 Identity = 35/40 (87.50%), Postives = 37/40 (92.50%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELG+EA+YAG FR PVEPY Sbjct: 405 GAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY 444
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_MESCR (Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.583e-14 Identity = 36/40 (90.00%), Postives = 37/40 (92.50%), Query Frame = -1 Query: 260 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 379 GAPCRSERLAKYNQLLRIEEELG +AVYAGA FR PVEPY Sbjct: 405 GAPCRSERLAKYNQLLRIEEELGDKAVYAGANFRRPVEPY 444 The following BLAST results are available for this feature:
BLAST of CN185917 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN185917 ID=CN185917; Name=CN185917; organism=Citrus sinensis; type=EST; length=382bpback to top |