CN185914

Overview
NameCN185914
Unique NameCN185914
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length726
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig305 contig Csv1_Contig305:402..1127. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. japonica GN=SAP8 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.081e-32
Identity = 67/102 (65.69%), Postives = 77/102 (75.49%), Query Frame = -2
Query:  426 AATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 725
            A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI KANPV+KAEKLDKI
Sbjct:   70 AGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI 171          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSI (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. indica GN=SAP8 PE=2 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.081e-32
Identity = 67/102 (65.69%), Postives = 77/102 (75.49%), Query Frame = -2
Query:  426 AATVDVQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 725
            A   +V  + VE K +  QP+  +  SE V   PK  EGP+RCS+C+KRVGLTGF CRCGNLYC  HRYSDKH+C FDYRTAARDAI KANPV+KAEKLDKI
Sbjct:   70 AGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI 171          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: SAP4_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Oryza sativa subsp. japonica GN=SAP4 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.144e-32
Identity = 65/97 (67.01%), Postives = 75/97 (77.32%), Query Frame = -2
Query:  426 VQASSVEPKIISVQPSCASELSESVEAKPK--EGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 710
            V  + VE K + VQP+  +  SE V   PK  EGP+RC++C+KRVGLTGF CRCGN+YC  HRYSDKH C FDYRTAARDAI KANPV+KAEKLDKI
Sbjct:   77 VAVAQVEAKTLVVQPTDVAGTSEEVAVVPKVKEGPNRCATCRKRVGLTGFNCRCGNMYCALHRYSDKHECQFDYRTAARDAIAKANPVVKAEKLDKI 173          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: SAP2_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 2 OS=Arabidopsis thaliana GN=SAP2 PE=2 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 3.476e-31
Identity = 65/104 (62.50%), Postives = 81/104 (77.88%), Query Frame = -2
Query:  426 AATVDVQASSVEPKIISVQPSCASELSESVE----AKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 725
            AA VD++  SVEP  +SVQPS    ++E V     AKPK GPSRC++C KRVGLTGFKCRCG+L+C +HRY+D H+C F+Y  AA++AI KANPV+KAEKLDKI
Sbjct:   71 AALVDIETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPK-GPSRCTTCNKRVGLTGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANPVVKAEKLDKI 173          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: SAP11_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 11 OS=Oryza sativa subsp. japonica GN=SAP11 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.324e-22
Identity = 46/92 (50.00%), Postives = 65/92 (70.65%), Query Frame = -2
Query:  435 VQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKL 710
            VQ+S+     + V+   A  +  S +A      +RC SC++RVGLTGF+CRCG LYC +HRYSD+H+C FDY++AARDAI + NPV++A K+
Sbjct:   76 VQSSAAAAVALVVERPTAGPVESSSKASRSSSVNRCHSCRRRVGLTGFRCRCGELYCGAHRYSDRHDCSFDYKSAARDAIARENPVVRAAKI 167          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: ZFAN5_MOUSE (AN1-type zinc finger protein 5 OS=Mus musculus GN=Zfand5 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.912e-21
Identity = 48/93 (51.61%), Postives = 59/93 (63.44%), Query Frame = -2
Query:  426 EPKIISVQPSCASELSESVEAK----PKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 692
            EP +    PS +   S   E K    PK   +RC  C+K+VGLTGF CRCGNL+C  HRYSDKHNCP+DY+  A   I K NPV+ AEK+ +I
Sbjct:  121 EPVVTQPSPSVSQPSSSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI 213          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: SAP9_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Oryza sativa subsp. japonica GN=SAP9 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.261e-21
Identity = 44/90 (48.89%), Postives = 62/90 (68.89%), Query Frame = -2
Query:  426 VEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 695
            +EP      P+ A E  ++ +  PK   +RC SC+K+VGLTGF+CRCG  +C +HRY++ H+C FDY+ A RD I K NPV+ AEK++KI
Sbjct:   72 LEPAKPDEVPAAAVEDKQAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNPVVIAEKINKI 161          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: SAP7_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Arabidopsis thaliana GN=SAP7 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.261e-21
Identity = 42/100 (42.00%), Postives = 70/100 (70.00%), Query Frame = -2
Query:  426 VDVQASSVEPKIISVQPSC---ASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 716
            ++++ + +E  +++ +PS    A+E  E+  ++P    +RC SC K+VG+ GFKC+CG+ +C SHRY +KH C FD++   RDAI KANP++KA+K+ +I
Sbjct:   76 LEIKPAHLETVVVTAEPSSVPVAAEQDEAEPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVKADKVQRI 175          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: ZFAN5_HUMAN (AN1-type zinc finger protein 5 OS=Homo sapiens GN=ZFAND5 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.259e-21
Identity = 47/93 (50.54%), Postives = 59/93 (63.44%), Query Frame = -2
Query:  426 EPKIISVQPSCASELSESVEAK----PKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 692
            EP +    PS +   +   E K    PK   +RC  C+K+VGLTGF CRCGNL+C  HRYSDKHNCP+DY+  A   I K NPV+ AEK+ +I
Sbjct:  121 EPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI 213          
BLAST of CN185914 vs. ExPASy Swiss-Prot
Match: ZFAN6_HUMAN (AN1-type zinc finger protein 6 OS=Homo sapiens GN=ZFAND6 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 5.563e-21
Identity = 52/98 (53.06%), Postives = 68/98 (69.39%), Query Frame = -2
Query:  426 TVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIKAEKLDKI 719
            T DVQAS  +    + QPS   E S+S+E KPK+  +RC  C+K+VGLTGF+CRCGN+YC  HRYSD HNC ++Y+  A + I K NPV+  EK+ KI
Sbjct:  117 TEDVQASVSDT---AQQPS--EEQSKSLE-KPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
The following BLAST results are available for this feature:
BLAST of CN185914 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
SAP8_ORYSJ1.081e-3265.69Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP8_ORYSI1.081e-3265.69Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ORYSJ3.144e-3267.01Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP2_ARATH3.476e-3162.50Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP11_ORYSJ1.324e-2250.00Zinc finger A20 and AN1 domain-containing stress-a... [more]
ZFAN5_MOUSE1.912e-2151.61AN1-type zinc finger protein 5 OS=Mus musculus GN=... [more]
SAP9_ORYSJ3.261e-2148.89Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP7_ARATH3.261e-2142.00Zinc finger A20 and AN1 domain-containing stress-a... [more]
ZFAN5_HUMAN4.259e-2150.54AN1-type zinc finger protein 5 OS=Homo sapiens GN=... [more]
ZFAN6_HUMAN5.563e-2153.06AN1-type zinc finger protein 6 OS=Homo sapiens GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A22_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185914 ID=CN185914|Name=CN185914|organism=Citrus sinensis|type=EST|length=726bp
AGTTAAAGCCGATAGAAACCATAATTAAAAATTTACAGAGGCTAAGCGCA
AGAATTGTCCATGTATGTTTTCCACATCATATGGAAATAGCACAACCATC
TTTTTCTGAATTTTTTTTTTTAAGCAGAAACTAATAAAGTGAAATGCCAT
ATGAAACATAATGACAAATTGGAAAGCTATCCAAAAGTCCATAAAACCAG
AGCACAGATTCACTCTTAAACACTGAAGCCAACATATAAGTTCTCGCCAA
CACACGACATAGAGTTCTTCATACTGCAGAGATGTCCTATAACTGATAAT
GGGCCCCCAGCATATATAACATTAAAGGACACCTGATAAGATACGTGGCC
TTCTCAGAAGAAGCCTCTAACAGATGAGCAAGATCATCATTCTTTGATTA
TTGAAACCTCATCCCATTGAATCTAGATTTTATCTAGCTTCTCAGCCTTG
ATCACAGGGTTTGCTTTAATTATAGCATCCCTAGCAGCAGTGCGGTAGTC
AAAGGGGCAGTTATGTTTGTCCGAATAGCGATGTGACACACAGTATAAGT
TACCACAGCGACATTTGAATCCTGTTAAACCAACACGCTTCTTGCAACTG
CTGCACCGGCTGGGACCCTCCTTCGGCTTTGCCTCCACACTCTCGCTCAA
TTCTGAAGCACATGATGGCTGCACAGAGATGATTTTTGGCTCCACTGAAC
TAGCTTGCACATCAACAGTGGCAGCA
back to top