CN185909

Overview
NameCN185909
Unique NameCN185909
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length825
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185909_ssr159 microsatellite CN185909_ssr159:159..168. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: GOX2_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 OS=Arabidopsis thaliana GN=At3g14420 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.816e-22
Identity = 50/56 (89.29%), Postives = 54/56 (96.43%), Query Frame = 2
Query:  656 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSK 823
            EITNV EY+A+AK+KLPKMVYDYYASGAEDQWTLQENRNAF+RILFRPRIL DVSK
Sbjct:    2 EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSK 57          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: GOX1_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 OS=Arabidopsis thaliana GN=At3g14415 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.397e-21
Identity = 49/56 (87.50%), Postives = 53/56 (94.64%), Query Frame = 2
Query:  656 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSK 823
            EITNV EY+A+AK KLPKMVYDYYASGAEDQWTLQENRNAF+RILFRPRIL DV+K
Sbjct:    2 EITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNK 57          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: GOX_SPIOL (Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.113e-21
Identity = 49/55 (89.09%), Postives = 52/55 (94.55%), Query Frame = 2
Query:  656 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVS 820
            EITNV EYEA+AK+KLPKMVYDYYASGAEDQWTL ENRNAFSRILFRPRIL DV+
Sbjct:    2 EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVT 56          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.708e-19
Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = -2
Query:  309 TATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 464
            TA C+DIL+A+I PPLGVFLKFGC  EFWICLLLT LGYIPGIIYA+YAITK
Sbjct:    4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.708e-19
Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = -2
Query:  309 TATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 464
            TA C+DIL+A+I PPLGVFLKFGC  EFWICLLLT LGYIPGIIYA+YAITK
Sbjct:    4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.491e-19
Identity = 44/57 (77.19%), Postives = 49/57 (85.96%), Query Frame = -2
Query:  309 MADGSTATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 479
            MAD STATC+DI+LA+I PPLGVF KFGC  EFWICLLLT  GY+PGIIYAV+ ITK
Sbjct:    1 MAD-STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.221e-18
Identity = 40/53 (75.47%), Postives = 48/53 (90.57%), Query Frame = -2
Query:  309 STATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 467
            STAT V+I+LA+I PPLGVFLKFGCK EFWICL+LT+ GY+PGI+YA+Y ITK
Sbjct:    2 STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 5.495e-18
Identity = 39/53 (73.58%), Postives = 48/53 (90.57%), Query Frame = -2
Query:  309 STATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 467
            STAT VDI++A++ PPLGVFL+FGC  EFWICL+LT+LGYIPGIIYA+Y +TK
Sbjct:    2 STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.655e-14
Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = -2
Query:  315 MADGSTATCVDILLAVISPPLGVFLKFGC-KAEFWICLLLTILGYIPGIIYAVYAI 479
            MA G   T ++ILLA+I PPLGVFL+FGC   EF ICLLLTILGY+PGIIYAVY +
Sbjct:    1 MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVL 56          
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.655e-14
Identity = 33/51 (64.71%), Postives = 45/51 (88.24%), Query Frame = -2
Query:  315 STATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 467
            ++AT ++++LA+I PP+GVFL++G   EFWICLLLT+LGYIPGIIYAVY +
Sbjct:    2 ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVL 52          
The following BLAST results are available for this feature:
BLAST of CN185909 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
GOX2_ARATH2.816e-2289.29Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 ... [more]
GOX1_ARATH1.397e-2187.50Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 ... [more]
GOX_SPIOL3.113e-2189.09Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia... [more]
LTI6B_ORYSJ1.708e-1982.69Hydrophobic protein LTI6B OS=Oryza sativa subsp. j... [more]
LTI6B_ORYSI1.708e-1982.69Hydrophobic protein LTI6B OS=Oryza sativa subsp. i... [more]
LTI6A_ORYSJ6.491e-1977.19Hydrophobic protein LTI6A OS=Oryza sativa subsp. j... [more]
RCI2B_ARATH3.221e-1875.47Hydrophobic protein RCI2B OS=Arabidopsis thaliana ... [more]
RCI2A_ARATH5.495e-1873.58Hydrophobic protein RCI2A OS=Arabidopsis thaliana ... [more]
OSR8_ORYSJ1.655e-1469.64Hydrophobic protein OSR8 OS=Oryza sativa subsp. ja... [more]
LT02_HORVU1.655e-1464.71Low temperature-induced protein lt101.2 OS=Hordeum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A20_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A20, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185909 ID=CN185909|Name=CN185909|organism=Citrus sinensis|type=EST|length=825bp
CTTTTTTGGTTTGTGGGGACTGNAATGATTCACAAGGCAATTTACACACT
CACTATTACTCCACTTTACATCAACATATTGAATTAAAATTCATCCTAAA
GGACAAATGAAAGAAAAGAAAACGATAAAGATTAACAAACGAAACAAGTG
CTCTCTCCCACACACACACGCACACCCCAGTTGATTAAGAATCAGAACCC
ATCTGGGGGCATCAAATCAGAGCTGCCCATCTAACGGTTGTAAATAAAAG
ATCTCATAACACATGATGCCCTTGGGATCTCTCAATAGATGAAGACGAGA
GATCACTTCTTGGTGATGGCATAAACAGCATAAATAATTCCAGGGATATA
CCCCAGAATTGTCAAGAGCAAACAGATCCAAAACTCAGCCTTGCAACCAA
ATTTGAGAAAGACACCAAGAGGAGGCGAGATAACAGCCAAGAGAATATCT
ACGCATGTTGCTGTGCTTCCATCTGCCATCTTTGATTGATTCTTAAAAAG
TGTAAAATGGAATAAAATAAAATTTAGAGTCAAAAAACCTCTTCCTTCAG
TCTTCATTTCCCAGTTTCTGACTTTATTGCTTTGCGCTCCCTTCACTGAT
TCATTTCTGCTTCTTTTGTTGTTCAAGGAAGCCAAGCATTATGACTTATA
TATCGGAGATCACCAATGTTATGGAGTATGAGGCTCTTGCAAAGGAGAAA
TTGCCGAAGATGGTTTATGACTACTATGCATCAGGTGCTGAGGACCAGTG
GACTCTTCAGGAAAACCGTAATGCATTCTCTAGGATTCTATTTCGACCAC
GCATTCTTAGAGATGTAAGCAAGAT
back to top