DC900086

Overview
NameDC900086
Unique NameDC900086
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length621
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4219 contig Csv1_Contig4219:414..1034. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900086 vs. ExPASy Swiss-Prot
Match: PME3_PHAVU (Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.882e-14
Identity = 55/165 (33.33%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  114 MDAINVMKGYDKVDHHQHRAGIHSLRTHQRLKIAVTISAIVLLTLIIGLMLAVLIRESNTEE--------QQQLDAAKSIKTVCSVTQNPDSCFXXXXXXXXXXXXXXKPDPEVILKLSLQVNVNHFSNITSSIK--SLYGNHLEXALRDCVDQLRDASSRLNDS 578
            MD I   KGY KV+  + +A  +  +T +RL I + +S+IVL+ +II  +  V+I   N+E         Q +L  A S+K VC  T+ P SCF                DPE++ KLSL+V ++  S+  S ++  +     L+ A+  C     DA  RLNDS
Sbjct:    1 MDTIKSFKGYGKVNELEQQA--YEKKTRKRL-IIIAVSSIVLIAVIIAAVAGVVIHNRNSESSPSSDSVPQTELSPAASLKAVCDTTRYPSSCF----SSISSLPESNTTDPELLFKLSLRVAIDELSSFPSKLRANAEQDARLQKAIDVCSSVFGDALDRLNDS 158          
BLAST of DC900086 vs. ExPASy Swiss-Prot
Match: PME1_ARATH (Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.882e-14
Identity = 53/163 (32.52%), Postives = 85/163 (52.15%), Query Frame = 3
Query:  114 MDAINVMKGYDKVDHHQHRAGIHSLRTHQRLKIAVTISAIVLLTLIIGLMLAVLIRESNTEEQQ----QLDAAKSIKTVCSVTQNPDSCFXXXXXXXXXXXXXXKPDPEVILKLSLQVNVNHFSNIT----SSIKSLYGNHLEXALRDCVDQLRDASSRLNDS 578
            MD++N  KGY KVD  Q  A     +T +RL + ++IS +VL+ +II  ++A ++ ++  E       +L  + S+K +CSVT+ P+SC                 DPE + KLSL+V ++   +I+       K      ++ ALR C D + DA  RLND+
Sbjct:    1 MDSVNSFKGYGKVDEAQDLA--LKKKTRKRL-LLLSISVVVLIAVIIAAVVATVVHKNKNESTPSPPPELTPSTSLKAICSVTRFPESCI----SSISKLPSSNTTDPETLFKLSLKVIIDELDSISDLPEKLSKETEDERIKSALRVCGDLIEDALDRLNDT 156          
The following BLAST results are available for this feature:
BLAST of DC900086 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PME3_PHAVU2.882e-1433.33Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=... [more]
PME1_ARATH2.882e-1432.52Pectinesterase 1 OS=Arabidopsis thaliana GN=PME1 P... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900086 VSS Citrus sinensis cDNA clone VS27Q94 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900086 ID=DC900086|Name=DC900086|organism=Citrus sinensis|type=EST|length=621bp
TATTTTTTAATTAAAAATTTTAATATTTGCTATTTATTGTACTTATTTCC
TTCTAATCTACGCAAAAAAGAAAGAAATATCCACACGTCCAGAAGGACCA
AACAAGCACGAAGATGGATGCTATCAATGTCATGAAAGGCTACGACAAAG
TCGATCACCACCAACACCGCGCAGGAATTCATTCCCTTCGGACACATCAG
CGTCTGAAAATCGCCGTCACCATCTCAGCCATTGTTTTGTTGACCTTGAT
CATCGGTCTGATGCTTGCAGTTCTCATCCGGGAATCAAACACTGAAGAAC
AACAGCAACTGGACGCTGCCAAGTCGATCAAAACGGTGTGCAGCGTTACC
CAGAACCCGGATTCATGCTTCACCGCCTTATCTTCTTCTCTCAACATCTC
ATCGACAACGACAAAACCAGACCCAGAAGTGATCTTGAAGCTCTCTCTGC
AAGTCAACGTCAATCACTTCTCAAACATCACTTCTTCGATTAAAAGTCTT
TACGGTAATCACCTTGAGGNTGCTTTACGCGACTGCGTGGATCAGCTGCG
GGACGCGTCGAGTCGACTCAACGACTCCTGTCTGAGTTGACGCCCGTTGA
CTGACGGACTGTCACGACATC
back to top