CN185901

Overview
NameCN185901
Unique NameCN185901
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length760
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2611 contig Csv1_Contig2611:202..957. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK75_ARATH (Probable WRKY transcription factor 75 OS=Arabidopsis thaliana GN=WRKY75 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.132e-43
Identity = 81/92 (88.04%), Postives = 88/92 (95.65%), Query Frame = -3
Query:  354 RYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPIERSTDNFEHILNQMQIYTSY 629
            RYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCT+ GCNVKKQVQRLT D+ VVVTTYEG+HSHPIE+ST+NFEHIL QMQIY+S+
Sbjct:   54 RYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTYGGCNVKKQVQRLTVDQEVVVTTYEGVHSHPIEKSTENFEHILTQMQIYSSF 145          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK45_ARATH (Probable WRKY transcription factor 45 OS=Arabidopsis thaliana GN=WRKY45 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.858e-37
Identity = 68/92 (73.91%), Postives = 79/92 (85.87%), Query Frame = -3
Query:  354 RYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPIERSTDNFEHILNQMQIYTSY 629
            RYAFQTRSQVDILDDGYRWRKYGQKAVKNN FPRSYY+CT +GC VKKQVQR   DEGVVVTTY+G+H+H +++ +DNF HIL QM I+  +
Sbjct:   52 RYAFQTRSQVDILDDGYRWRKYGQKAVKNNPFPRSYYKCTEEGCRVKKQVQRQWGDEGVVVTTYQGVHTHAVDKPSDNFHHILTQMHIFPPF 143          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK24_ARATH (Probable WRKY transcription factor 24 OS=Arabidopsis thaliana GN=WRKY24 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.933e-31
Identity = 60/93 (64.52%), Postives = 72/93 (77.42%), Query Frame = -3
Query:  354 PRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPIERSTDNFEHILNQMQIYTSY 632
            PR AF TRS  D+LDDGYRWRKYGQK+VK+N  PRSYYRCT+  CNVKKQVQRL KD  VVVTTYEG+H+HP E+  +    +L Q+Q  +S+
Sbjct:   84 PRIAFHTRSDDDVLDDGYRWRKYGQKSVKHNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGVHNHPCEKLMETLNPLLRQLQFLSSF 176          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK56_ARATH (Probable WRKY transcription factor 56 OS=Arabidopsis thaliana GN=WRKY56 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 5.454e-30
Identity = 59/87 (67.82%), Postives = 68/87 (78.16%), Query Frame = -3
Query:  369 RYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPIERSTDNFEHILNQMQ 629
            R AF TRS  D+LDDGYRWRKYGQK+VKNN  PRSYYRCT+  CNVKKQVQRL KD  VVVTTYEG+H+HP E+  +    +L Q+Q
Sbjct:  101 RIAFHTRSDDDVLDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGVHNHPCEKLMETLSPLLRQLQ 187          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK43_ARATH (Probable WRKY transcription factor 43 OS=Arabidopsis thaliana GN=WRKY43 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.707e-29
Identity = 55/93 (59.14%), Postives = 72/93 (77.42%), Query Frame = -3
Query:  354 PRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPIERSTDNFEHILNQMQIYTSY 632
            PR++F+T+S  DILDDGYRWRKYGQK+VKN+ +PRSYYRCT   CNVKKQVQRL+K+  +V TTYEG+H+HP E        +L+Q+Q  + +
Sbjct:   16 PRFSFRTKSDADILDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKETSIVETTYEGIHNHPCEELMQTLTPLLHQLQFLSKF 108          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK71_ARATH (Probable WRKY transcription factor 71 OS=Arabidopsis thaliana GN=WRKY71 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 6.241e-26
Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = -3
Query:  381 RYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPIE---RSTDNFEHIL 629
            R AF T+S++D L+DGYRWRKYGQKAVKN+ +PRSYYRCT Q CNVKK+V+R  +D  +V+TTYEG H+HPI    R T   EH+L
Sbjct:  123 RVAFMTKSEIDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPSIVITTYEGKHNHPIPSTLRGTVAAEHLL 208          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK28_ARATH (Probable WRKY transcription factor 28 OS=Arabidopsis thaliana GN=WRKY28 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.064e-25
Identity = 51/73 (69.86%), Postives = 62/73 (84.93%), Query Frame = -3
Query:  414 PRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPI 632
            PR +F T+S+VD L+DGYRWRKYGQKAVKN+ +PRSYYRCT Q CNVKK+V+R  +D  VV+TTYEG H+HPI
Sbjct:  158 PRVSFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPTVVITTYEGQHNHPI 230          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK12_ARATH (Probable WRKY transcription factor 12 OS=Arabidopsis thaliana GN=WRKY12 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.816e-25
Identity = 51/78 (65.38%), Postives = 64/78 (82.05%), Query Frame = -3
Query:  402 PRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSH-PIERST 632
            PR+ FQT+S VD+LDDGY+WRKYGQK VKN+  PRSYYRCTH  C VKK+V+RL++D  +V+TTYEG H+H P + ST
Sbjct:  131 PRFCFQTKSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHIPSDDST 208          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRKY8_ARATH (Probable WRKY transcription factor 8 OS=Arabidopsis thaliana GN=WRKY8 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.177e-24
Identity = 49/73 (67.12%), Postives = 61/73 (83.56%), Query Frame = -3
Query:  414 PRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPI 632
            PR +F T+++VD L+DGYRWRKYGQKAVKN+ +PRSYYRCT Q CNVKK+V+R  +D  VV+TTYE  H+HPI
Sbjct:  169 PRVSFMTKTEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHNHPI 241          
BLAST of CN185901 vs. ExPASy Swiss-Prot
Match: WRK48_ARATH (Probable WRKY transcription factor 48 OS=Arabidopsis thaliana GN=WRKY48 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.537e-24
Identity = 48/71 (67.61%), Postives = 59/71 (83.10%), Query Frame = -3
Query:  417 RYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHP 629
            R+AF T+S +D LDDGYRWRKYGQKAVKN+ +PRSYYRCT  GC VKK+V+R + D  +V+TTYEG H+HP
Sbjct:  208 RFAFLTKSDIDNLDDGYRWRKYGQKAVKNSPYPRSYYRCTTVGCGVKKRVERSSDDPSIVMTTYEGQHTHP 278          
The following BLAST results are available for this feature:
BLAST of CN185901 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 61
Match NameE-valueIdentityDescription
WRK75_ARATH1.132e-4388.04Probable WRKY transcription factor 75 OS=Arabidops... [more]
WRK45_ARATH7.858e-3773.91Probable WRKY transcription factor 45 OS=Arabidops... [more]
WRK24_ARATH4.933e-3164.52Probable WRKY transcription factor 24 OS=Arabidops... [more]
WRK56_ARATH5.454e-3067.82Probable WRKY transcription factor 56 OS=Arabidops... [more]
WRK43_ARATH2.707e-2959.14Probable WRKY transcription factor 43 OS=Arabidops... [more]
WRK71_ARATH6.241e-2662.79Probable WRKY transcription factor 71 OS=Arabidops... [more]
WRK28_ARATH1.064e-2569.86Probable WRKY transcription factor 28 OS=Arabidops... [more]
WRK12_ARATH1.816e-2565.38Probable WRKY transcription factor 12 OS=Arabidops... [more]
WRKY8_ARATH1.177e-2467.12Probable WRKY transcription factor 8 OS=Arabidopsi... [more]
WRK48_ARATH1.537e-2467.61Probable WRKY transcription factor 48 OS=Arabidops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A15_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185901 ID=CN185901|Name=CN185901|organism=Citrus sinensis|type=EST|length=760bp
TTTTTTTTTTTTTTTCTTATGCAAATGTTTGATAGATAATAGTTAACTCT
TAATGGCCTAGAAACTGAAGTAGATTAAAAAAAAAATCCCATAAAAAGAG
AACAAAATAATGAACCAAATCACCAATGCAGGCAAGTTCTGTTTCTAAAT
TCTAATGACTGCACACAGTACAACAAACTAAAAGGCATTGCCATAAAAAT
ACAACATGTGTTCAAATTATACTAGAGAAGTATCCTGCCCAGTGCTCTGG
AAATTTTATTTCGAGGGTTCAAGTTTATGGATGCTAGATAATTTACAACG
TATTAAGAAGTATCTAGCCCTTTACTGCTGCTTGCTAGTTGAGGAGTGAA
TTAATAAGAAGTGTAGATTTGCATCTGGTTCAAGATGTGCTCGAAGTTAT
CAGTTGATCTCTCGATGGGATGTGAATGCATTCCTTCGTAAGTTGTCACC
ACAACTCCTTCATCTTTGGTTAGTCGTTGAACTTGCTTCTTCACATTGCA
GCCTTGATGCGTGCATCGGTAGTAGCTTCTTGGAAACTTGTTGTTTTTAA
CAGCTTTTTGGCCATACTTTCGCCATCTATAGCCATCATCAAGTATATCA
ACTTGGCTTCGTGTTTGAAAAGCATATCTTGGCTTTCTCACCTTCTTCTC
TCCCTTTTTAATCTTTCCCATTTTCTCTCCGTTTTCAGACCCTGTTTCGT
ACAATAAAGAGCCCTCTATTTCCAGTTTTAAGTTCTAAGTTCTAAGCTCA
ATCAACATGT
back to top