CN185895

Overview
NameCN185895
Unique NameCN185895
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length727
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1957 contig Csv1_Contig1957:62..788. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI1_SALBA (Protein translation factor SUI1 homolog OS=Salix bakko PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.544e-55
Identity = 104/113 (92.04%), Postives = 110/113 (97.35%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MSEFD  IP+AFDPFAEANAEDSGAG+KDYVH+RVQQRNGRKSLTTVQGLKK++SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKE IKIHGF
Sbjct:    1 MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKIHGF 113          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI1_ORYSJ (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. japonica GN=GOS2 PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.493e-53
Identity = 104/115 (90.43%), Postives = 108/115 (93.91%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MS+ D QIP+AFDPFAEANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKE IKIHGF
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI1_ORYSI (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica GN=GOS2 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.493e-53
Identity = 104/115 (90.43%), Postives = 108/115 (93.91%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MS+ D QIP+AFDPFAEANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKE IKIHGF
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI1_SPOST (Protein translation factor SUI1 homolog OS=Sporobolus stapfianus PE=3 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 5.555e-53
Identity = 103/115 (89.57%), Postives = 108/115 (93.91%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MS+ D QIP+AFDPF+EANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKE IKIHGF
Sbjct:    1 MSDLDIQIPTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI11_ARATH (Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana GN=At4g27130 PE=2 SV=2)

HSP 1 Score: 207.608 bits (527), Expect = 5.555e-53
Identity = 100/113 (88.50%), Postives = 109/113 (96.46%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MSE D+Q+P+AFDPFA+ANAEDSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK+ IKIHGF
Sbjct:    1 MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI1_MAIZE (Protein translation factor SUI1 homolog OS=Zea mays GN=TIF PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 9.475e-53
Identity = 103/115 (89.57%), Postives = 108/115 (93.91%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGA--GSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MS+ D QIP+AFDPFAEANA DSGA  GSKDYVH+R+QQRNGRKSLTTVQGLKKEFSY+KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKE IKIHGF
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI1_BRAOL (Protein translation factor SUI1 homolog OS=Brassica oleracea PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.616e-52
Identity = 99/113 (87.61%), Postives = 109/113 (96.46%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MSE D+Q+P+AFDPFA+ANAEDSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK+ I+IHGF
Sbjct:    1 MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDDIQIHGF 113          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI12_ARATH (Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana GN=At1g54290 PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.601e-52
Identity = 98/113 (86.73%), Postives = 109/113 (96.46%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            MS+ + Q+P+AFDPFA+ANAEDSGAG+K+YVHIRVQQRNGRKSLTTVQGLKKE+SY+KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK+ IKIHGF
Sbjct:    1 MSDLEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: SUI1_PIMBR (Protein translation factor SUI1 homolog OS=Pimpinella brachycarpa PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.371e-43
Identity = 85/113 (75.22%), Postives = 97/113 (85.84%), Query Frame = -1
Query:  284 MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 622
            M + D QIP++FDPFAEA   D+   +K+YVHIR+QQRNGRKSLTTVQGLKKE SY+KILKDLKK  CCNGTVV D ELG+VIQLQGDQRKNVSTF+VQAGIVKK+ IK+H F
Sbjct:    1 MVDSDIQIPTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKILKDLKKALCCNGTVVNDKELGKVIQLQGDQRKNVSTFIVQAGIVKKDQIKVHNF 113          
BLAST of CN185895 vs. ExPASy Swiss-Prot
Match: EIF1B_PIG (Eukaryotic translation initiation factor 1b OS=Sus scrofa GN=EIF1B PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.220e-32
Identity = 62/105 (59.05%), Postives = 84/105 (80.00%), Query Frame = -1
Query:  284 AFDPFAEANAEDS--GAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF 592
            +FDPFA+A   D    AG++DY+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FL++ GIVK+E +K+HGF
Sbjct:    9 SFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113          
The following BLAST results are available for this feature:
BLAST of CN185895 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
SUI1_SALBA4.544e-5592.04Protein translation factor SUI1 homolog OS=Salix b... [more]
SUI1_ORYSJ2.493e-5390.43Protein translation factor SUI1 homolog OS=Oryza s... [more]
SUI1_ORYSI2.493e-5390.43Protein translation factor SUI1 homolog OS=Oryza s... [more]
SUI1_SPOST5.555e-5389.57Protein translation factor SUI1 homolog OS=Sporobo... [more]
SUI11_ARATH5.555e-5388.50Protein translation factor SUI1 homolog 1 OS=Arabi... [more]
SUI1_MAIZE9.475e-5389.57Protein translation factor SUI1 homolog OS=Zea may... [more]
SUI1_BRAOL1.616e-5287.61Protein translation factor SUI1 homolog OS=Brassic... [more]
SUI12_ARATH3.601e-5286.73Protein translation factor SUI1 homolog 2 OS=Arabi... [more]
SUI1_PIMBR1.371e-4375.22Protein translation factor SUI1 homolog OS=Pimpine... [more]
EIF1B_PIG9.220e-3259.05Eukaryotic translation initiation factor 1b OS=Sus... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A12_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185895 ID=CN185895|Name=CN185895|organism=Citrus sinensis|type=EST|length=727bp
TTTTGAGGCGGAACAAACAACTATTCATATGAATTGAAAGCAGGAATACA
TCTTATTTTGCTTAAAATAAGTCTTGGAAGAAACCATAATATTCCCAAAC
AAAAGAACACTACTACAAACTAAAAAGTTTAAACGCACAAGCAAGCTTGC
ATCAAACTTTTTGTTTGGACAGCGTTACATAACACAACAGTCAATAATAA
ATTAATATATAGATCATATACTTCTTGCTACCAATAGTTGGAGATGGATA
AACAACATATAGCAACTTGGCTCCCACTATTTAGAAACCATGAATCTTGA
TGAATTCCTTCTTCACAATACCAGCCTGAACGAGGAAGGTGGACACATTC
TTCCTCTGGTCACCCTGAAGCTGTATGACCTGGCCTAACTCAGGGTCCTG
TACAACAGTACCATTACAGCAGAACTCTTTCTTGAGGTCCTTGAGAATCT
TGTTGTAGCTGAATTCTTTCTTCAACCCTTGCACAGTTGTCAGGCTTTTC
CTCCCATTACGTTGCTGCACGCGAATATGCACATAATCTTTTGAACCAGC
ACCTGAGTCCTCAGCATTTGCCTCAGCAAAGGGATCAAAGGCAGATGGAA
TCTGGGTGTCAAATTCAGACATGAAACTTGGTTGTTGGAGTGTCAAAGAG
TCCGTAACCAGCAAGAAATTGGCTTCAATTCACTTAAATTGCTCTTAGCT
TAAGAGGAAGATTGCGAATCAAACCCT
back to top