DC900081

Overview
NameDC900081
Unique NameDC900081
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1096
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900081 vs. ExPASy Swiss-Prot
Match: DGDG2_SOYBN (Digalactosyldiacylglycerol synthase 2, chloroplastic OS=Glycine max GN=DGD2 PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 9.357e-118
Identity = 206/306 (67.32%), Postives = 248/306 (81.05%), Query Frame = 2
Query:   14 LEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAXLVGDVVTKRSKSPSRHXXXXXXXXXXXXXDAFGYLHYVASGFETSXXALGAIPGSLQPDEQLCKELGL 931
            LEYVKREKN  +QAFLL+++N+W+  ++CHKVIRLSAATQ+Y  SI+CNVHGVNPKFLEIG+KK EQQQ G  AFTKGAY+IG+M+WSKGY+ELL LL  + KEL+ LE+DL+G+GED D++Q+AA+KL+L VRV+P RDHAD +FHDYK+FLNPSTTDVVCT TAEALAMGKIVVCANHPSNDFFKQFPNC TYD  +GFV+ TLKALAE+PAQPTDAQ H LSWE+AT+RFL+ A L   +  K S++ S +             +A  Y+H+VASGFE S    GAIP SLQPDE+L KELGL
Sbjct:  153 LEYVKREKNGVMQAFLLKYLNNWVVSIYCHKVIRLSAATQDYTGSIICNVHGVNPKFLEIGKKKREQQQKGEHAFTKGAYFIGKMIWSKGYKELLQLLKDHEKELSALEVDLFGSGEDSDEVQKAAEKLELAVRVHPARDHADALFHDYKLFLNPSTTDVVCTTTAEALAMGKIVVCANHPSNDFFKQFPNCWTYDDDDGFVKLTLKALAEQPAQPTDAQRHDLSWEAATKRFLKAADLDKPLERKLSRTTS-NFLAASLNLQEKVDEASAYVHHVASGFEVSRRIFGAIPDSLQPDEELRKELGL 457          
BLAST of DC900081 vs. ExPASy Swiss-Prot
Match: DGDG2_LOTJA (Digalactosyldiacylglycerol synthase 2, chloroplastic OS=Lotus japonicus GN=DGD2 PE=2 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 6.065e-117
Identity = 207/306 (67.65%), Postives = 247/306 (80.72%), Query Frame = 2
Query:   14 LEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAXLVGDVVTKRSKSPSRHXXXXXXXXXXXXXDAFGYLHYVASGFETSXXALGAIPGSLQPDEQLCKELGL 931
            LEYVKREKN ++QAFLL+++N+W+  ++CHKVIRLSAATQ+Y  SIVCNVHGVNPKFLEIG+KK EQQQNG++AFTKGAY+IG+MVWSKGY+ELL L   + KEL+ LE+DL+G+GED D++Q+AAKKL++ VRV+P RDHAD +FHDYK+FLNPSTTDVVCT TAEALAMGKIVVCANH SN+FFKQFPNC T+D   GFV+  LKALAEEPAQ TDAQ H LSWE+ATERFL+ A L      K S+S S +             DA  Y+H+VASGFE S    GAIPGSL+PDE+L KELGL
Sbjct:  153 LEYVKREKNGQMQAFLLKYLNNWVVGIYCHKVIRLSAATQDYSGSIVCNVHGVNPKFLEIGKKKREQQQNGDQAFTKGAYFIGKMVWSKGYKELLHLFKNHQKELSALEVDLFGSGEDSDEVQKAAKKLEMAVRVHPARDHADALFHDYKLFLNPSTTDVVCTTTAEALAMGKIVVCANHCSNEFFKQFPNCWTFDESKGFVQLILKALAEEPAQLTDAQRHDLSWEAATERFLKAAELDKPFEKKLSRSTSIY-MSTSLNLQQTVDDASAYVHHVASGFEISRRMFGAIPGSLKPDEELSKELGL 457          
BLAST of DC900081 vs. ExPASy Swiss-Prot
Match: DGDG2_ARATH (Digalactosyldiacylglycerol synthase 2, chloroplastic OS=Arabidopsis thaliana GN=DGD2 PE=2 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 1.826e-113
Identity = 203/311 (65.27%), Postives = 243/311 (78.14%), Query Frame = 2
Query:   14 LEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAXL-----VGDVVTKRSKSPSRHXXXXXXXXXXXXXDAFGYLHYVASGFETSXXALGAIPGSLQPDEQLCKELGL 931
            LEYVKREK  R++AF L+++NSW+  ++CHKVIRLSAATQEYP SIVCNVHGVNPKFLEIG +K+EQQ+   + FTKGAYYIG+MVWSKGY+ELL LL  + KELA LE+DLYG+GED ++I+ AA+KL L V VYPGRDHAD +FH+YKVFLNPSTTDVVCT TAEALAMGKIVVCANH SN FFKQFPNCRTYD   GFV ATLKAL E+P+Q T+ Q H+LSWE+AT+RF++V+ L         ++KRS   S               D   Y+H++ASGFE S  A GAIPGSLQPDE+LC++LGL
Sbjct:  155 LEYVKREKQGRVKAFFLKYLNSWVVGIYCHKVIRLSAATQEYPKSIVCNVHGVNPKFLEIGLRKLEQQKLQEQPFTKGAYYIGKMVWSKGYKELLKLLEKHQKELAELEVDLYGDGEDSEEIKEAARKLDLTVNVYPGRDHADSLFHNYKVFLNPSTTDVVCTTTAEALAMGKIVVCANHISNKFFKQFPNCRTYDDGQGFVRATLKALGEQPSQLTEQQRHELSWEAATQRFIKVSDLNRLSRADSNLSKRSVFAS-----SSISVGKNLEDMSAYIHFLASGFEASRTAFGAIPGSLQPDEELCRDLGL 460          
BLAST of DC900081 vs. ExPASy Swiss-Prot
Match: DGDG1_SOYBN (Digalactosyldiacylglycerol synthase 1, chloroplastic OS=Glycine max GN=DGD1 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 8.542e-87
Identity = 157/314 (50.00%), Postives = 213/314 (67.83%), Query Frame = 2
Query:   14 LEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAXLVGDVVTKRSKSPSRHXXXXXXXXXXXXXD-------AFGYLHYVASGFETSXXALGAIPGSLQPDEQLCKELGLV 934
            LEY+KREKN  LQAFL++ +N+W+ R +CHKV+RLSAATQ+ P S++CNVHGVNPKFL+IGEK   +++ G KAFTKGAY++G+MVW+KGY+EL+ LL  +  +L G ++D++GNGED +++Q AA++L L +    GRDHAD   H YKVF+NPS +DV+CTATAEALAMGK VVCA+HPSN+FF+ FPNC TY     FV    +AL  EP   T  Q +QLSWE+AT+RF++ + L G +  + +   SR              +          + HY  +G E      GAIPG+   D+Q CK+L L+
Sbjct:  459 LEYIKREKNGALQAFLVKHINNWVTRAYCHKVLRLSAATQDLPKSVICNVHGVNPKFLKIGEKIAAERELGQKAFTKGAYFLGKMVWAKGYKELIDLLAKHKADLDGFKLDVFGNGEDANEVQSAARRLDLNLNFQKGRDHADDSLHRYKVFINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYRTSEDFVTKVKEALENEPYPLTPEQRYQLSWEAATQRFMEYSELDGILNKENNGEKSRVDKGKLIAKSASMPNLTELVDGGLAFAHYCLTGNEFLRLCTGAIPGTRDYDKQHCKDLHLL 772          
BLAST of DC900081 vs. ExPASy Swiss-Prot
Match: DGDG1_LOTJA (Digalactosyldiacylglycerol synthase 1, chloroplastic OS=Lotus japonicus GN=DGD1 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 2.326e-84
Identity = 156/316 (49.37%), Postives = 211/316 (66.77%), Query Frame = 2
Query:   14 LEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAXLVGDVVTKRSK---SPSRH------XXXXXXXXXXXXXDAFGYLHYVASGFETSXXALGAIPGSLQPDEQLCKELGLV 934
            LEY+KREKN  LQAFL++ +N+W+AR +C KV+RLSAATQ+ P S+VCNVHGVNPKFL+IGE    +++ G K FTKGAY++G+MVW+KGY+EL+ LL  +  +L G+++D++GNGED +++Q AA++  L +    GRDHAD   H YKVF+NPS +DV+CTATAEALAMGK VVCA+HPSN+FF+ FPNC TY     F     +ALA EP   T  Q +QLSWE+AT+RF++ + L  D V  + K    PS++                       + HY  +G E      GA PG+   D+Q CK+L L+
Sbjct:  462 LEYIKREKNGALQAFLVKHINNWVARAYCDKVLRLSAATQDLPKSVVCNVHGVNPKFLKIGESIAAERELGQKGFTKGAYFLGKMVWAKGYKELIDLLAKHKADLDGVKLDVFGNGEDANEVQSAARRFDLNLNFQKGRDHADDSLHRYKVFINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTPEDFAVKVKEALANEPYPLTPEQRYQLSWEAATQRFMEYSEL--DKVLNKEKDGAKPSKNNRKIMAKSASMPNLTELVDGGLAFAHYCLTGNEFLRLCTGATPGTRDYDKQHCKDLNLL 775          
BLAST of DC900081 vs. ExPASy Swiss-Prot
Match: DGDG1_ARATH (Digalactosyldiacylglycerol synthase 1, chloroplastic OS=Arabidopsis thaliana GN=DGD1 PE=1 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 3.968e-84
Identity = 154/308 (50.00%), Postives = 201/308 (65.26%), Query Frame = 2
Query:   14 LEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAXLVGDVVTKRSKSPSRHXXXXXXXXXXXXXD-AFGYLHYVASGFETSXXALGAIPGSLQPDEQLCKELGLV 934
            LEY+KREKN  LQAF +  VN+W+ R +C KV+RLSAATQ+ P S+VCNVHGVNPKFL IGEK  E++  G +AF+KGAY++G+MVW+KGY EL+ L+  +  EL    +D+YGNGED  ++QRAAKK  L +    GRDHAD   H YKVF+NPS +DV+CTATAEALAMGK VVCA+HPSN+FF+ FPNC TY     FV    +A+ +EP   T  Q + LSWE+AT+RF++ + L  D +    +   +              D    + HYV +G +      GA P +   D Q CK+L LV
Sbjct:  492 LEYIKREKNGALQAFFVNHVNNWVTRAYCDKVLRLSAATQDLPKSVVCNVHGVNPKFLMIGEKIAEERSRGEQAFSKGAYFLGKMVWAKGYRELIDLMAKHKSELGSFNLDVYGNGEDAVEVQRAAKKHDLNLNFLKGRDHADDALHKYKVFINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTSEDFVSKVQEAMTKEPLPLTPEQMYNLSWEAATQRFMEYSDL--DKILNNGEGGRKMRKSRSVPSFNEVVDGGLAFSHYVLTGNDFLRLCTGATPRTKDYDNQHCKDLNLV 797          
The following BLAST results are available for this feature:
BLAST of DC900081 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
DGDG2_SOYBN9.357e-11867.32Digalactosyldiacylglycerol synthase 2, chloroplast... [more]
DGDG2_LOTJA6.065e-11767.65Digalactosyldiacylglycerol synthase 2, chloroplast... [more]
DGDG2_ARATH1.826e-11365.27Digalactosyldiacylglycerol synthase 2, chloroplast... [more]
DGDG1_SOYBN8.542e-8750.00Digalactosyldiacylglycerol synthase 1, chloroplast... [more]
DGDG1_LOTJA2.326e-8449.37Digalactosyldiacylglycerol synthase 1, chloroplast... [more]
DGDG1_ARATH3.968e-8450.00Digalactosyldiacylglycerol synthase 1, chloroplast... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900081 VSS Citrus sinensis cDNA clone VS27Q88 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900081 ID=DC900081|Name=DC900081|organism=Citrus sinensis|type=EST|length=1096bp
AATTCGGCACGAGCTGGAATATGTCAAAAGGGAGAAGAATGATCGATTAC
AAGCATTTCTTCTTGAATTTGTAAATAGCTGGCTTGCTCGTGTCCATTGT
CACAAGGTAATTAGGCTATCTGCTGCCACACAGGAATATCCCAATTCCAT
CGTCTGCAATGTTCATGGAGTTAATCCCAAATTCCTTGAAATTGGCGAGA
AAAAGATGGAGCAACAACAAAATGGGAACAAGGCTTTCACAAAGGGCGCA
TACTATATTGGGAGGATGGTGTGGAGTAAAGGCTACGAGGAGCTACTTGG
ACTTCTTAATATTTACCACAAGGAGCTAGCAGGGCTTGAAATGGATTTAT
ATGGCAATGGGGAGGACTTCGATCAAATTCAAAGAGCAGCTAAAAAGTTA
AAACTTGTAGTTAGAGTTTACCCTGGACGTGATCATGCAGACCCCATATT
CCATGATTACAAAGTGTTCCTGAATCCAAGCACAACAGATGTTGTTTGCA
CAGCGACAGCTGAAGCATTGGCCATGGGCAAAATCGTTGTCTGTGCCAAC
CACCCCTCAAATGACTTCTTCAAGCAATTCCCAAATTGCCGAACTTACGA
TGGCAGAAATGGGTTTGTTGAAGCCACACTCAAAGCACTTGCTGAAGAGC
CTGCTCAACCAACTGATGCACAGACGCATCAACTGTCGTGGGAGTCTGCA
ACAGAAAGGTTTTTGCAAGTTGCTGANCTGGTCGGGGATGTTGTGACGAA
ACGGTCAAAAAGTCCTTCTAGGCACTTGGAATCCGAGTCATTAAATTCGA
ANANAATCATTGAGGATGCCTTCGGATATTTGCATTACGTTGCGTCTGGA
TTTGAAACATCAANAANAGCATTGGGTGCAATTCCTGGGAGCTTGCAACC
GGATGAACAACTGTGCAAGGAACTTGGATTGGTAACANAACTGGGCAAAG
NAAANTGTCACCGACCAAACGGAAGTTGGTTCGGTTCGGTTTTAGTACTA
GTCGGTTCGGTGATTGGCGTATTATTTGTAAAATCTGTAACNCTGAAATT
GNCCGTAAACGCACGTGTTGGTAGCAATAAGCATGCATTACTAAGG
back to top