CN185891

Overview
NameCN185891
Unique NameCN185891
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length733
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5924 contig Csv1_Contig5924:98..830. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UBC13_ARATH (Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana GN=UBC13 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 3.157e-72
Identity = 124/152 (81.58%), Postives = 133/152 (87.50%), Query Frame = -3
Query:  267 KDLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRRSQEM 722
            KDLCK+PV GFSAGLVDE NIFEWSVTIIGPPDTLYEGGFF AIMSFP NYPNSPPTV+FT++IWHPNVYPDGRVCISILHPPGDDP+GYELASERW PVHT E            PNDESPANVEAAKEWR++RD+FKKKV RCVR+SQEM
Sbjct:   14 KDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDIWHPNVYPDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAAKEWREKRDEFKKKVSRCVRKSQEM 165          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UBC7_ARATH (Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 5.385e-72
Identity = 123/152 (80.92%), Postives = 133/152 (87.50%), Query Frame = -3
Query:  267 KDLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRRSQEM 722
            KDLCK+PV GFSAGLVDE NIFEWSVTIIGPPDTLYEGGFFNAIM+FP NYPNSPPTV+FT+++WHPNVY DGRVCISILHPPGDDP+GYELASERW PVHT E            PNDESPANVEAAKEWRD+RD+FKKKV RCVR+SQEM
Sbjct:   14 KDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVRKSQEM 165          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UBC14_ARATH (Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana GN=UBC14 PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 7.278e-69
Identity = 119/153 (77.78%), Postives = 129/153 (84.31%), Query Frame = -3
Query:  264 KDLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRRSQEML 722
            KDLCK PV GFSAGLVDE N+F+WSV+I+GPPDTLYEGGFFNAIMSFP NYP SPPTV FT+E+WHPNVY DG+VCISILHPPGDDP+GYELASERW PVHT E            PNDESPANVEAAKEWRD R +F+KKV RCVRRSQEML
Sbjct:   15 KDLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTPVHTVESIVLSIISMLSGPNDESPANVEAAKEWRDNRAEFRKKVSRCVRRSQEML 167          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UBC7_WHEAT (Ubiquitin-conjugating enzyme E2 7 OS=Triticum aestivum GN=UBC7 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.018e-62
Identity = 108/147 (73.47%), Postives = 124/147 (84.35%), Query Frame = -3
Query:  264 PVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRRSQEML 704
            P  GF  G VD++N+FEW VTIIGPP+TLY+GG+FNAIMSFP NYPNSPPTV+FT+E+WHPNVYPDGRVCISI HPPGDDPNGYELASERW PVHT E           SPNDESPAN+EAAK+WR+++D+FKKKV R VR+SQEML
Sbjct:   23 PSMGFQLGFVDDSNVFEWQVTIIGPPETLYDGGYFNAIMSFPQNYPNSPPTVRFTSEMWHPNVYPDGRVCISI-HPPGDDPNGYELASERWTPVHTVESIVLSIISMLSSPNDESPANIEAAKDWREKQDEFKKKVRRAVRKSQEML 168          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UBC15_SCHPO (Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe GN=ubc15 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.613e-54
Identity = 98/153 (64.05%), Postives = 117/153 (76.47%), Query Frame = -3
Query:  264 KDLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRRSQEML 722
            K++ KNP  GFS GLVD+ +IFEW V IIGP DTLYEGGFF+A +SFP +YP  PP +KFTTEIWHPNV+P+G VCISILHPPGDD  GYE A ERW+PVH+ E           SPNDESPAN++AAKE+R+   +FKK+V R VRRS EM+
Sbjct:   15 KEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLSFPQDYPLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISMLSSPNDESPANIDAAKEFRENPQEFKKRVRRLVRRSIEMI 167          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UB2G1_RAT (Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 198.749 bits (504), Expect = 2.600e-50
Identity = 91/151 (60.26%), Postives = 110/151 (72.85%), Query Frame = -3
Query:  270 DLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWR-DRRDDFKKKVGRCVRRSQE 719
            +L KNPV GFSAGL+D+ +++ W V IIGPPDTLYEGG F A ++FP +YP  PP +KF TEIWHPNV  +G VCISILH PG+D  GYE   ERW+P+HT E            PN +SPANV+AAKEWR DR  +FK+KV RCVR+SQE
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UB2G1_MOUSE (Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 198.749 bits (504), Expect = 2.600e-50
Identity = 91/151 (60.26%), Postives = 110/151 (72.85%), Query Frame = -3
Query:  270 DLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWR-DRRDDFKKKVGRCVRRSQE 719
            +L KNPV GFSAGL+D+ +++ W V IIGPPDTLYEGG F A ++FP +YP  PP +KF TEIWHPNV  +G VCISILH PG+D  GYE   ERW+P+HT E            PN +SPANV+AAKEWR DR  +FK+KV RCVR+SQE
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UB2G1_HUMAN (Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3)

HSP 1 Score: 198.749 bits (504), Expect = 2.600e-50
Identity = 91/151 (60.26%), Postives = 110/151 (72.85%), Query Frame = -3
Query:  270 DLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWR-DRRDDFKKKVGRCVRRSQE 719
            +L KNPV GFSAGL+D+ +++ W V IIGPPDTLYEGG F A ++FP +YP  PP +KF TEIWHPNV  +G VCISILH PG+D  GYE   ERW+P+HT E            PN +SPANV+AAKEWR DR  +FK+KV RCVR+SQE
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UB2G1_MACFA (Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.686e-49
Identity = 90/151 (59.60%), Postives = 109/151 (72.19%), Query Frame = -3
Query:  270 DLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWR-DRRDDFKKKVGRCVRRSQE 719
            +L KNPV GFSAGL+D+ +++ W V IIGPPDTLYEGG F A ++FP +YP  PP +KF TEIWHPNV  +G VCISILH PG+D  GYE    RW+P+HT E            PN +SPANV+AAKEWR DR  +FK+KV RCVR+SQE
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEGRWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQE 166          
BLAST of CN185891 vs. ExPASy Swiss-Prot
Match: UBC7_CAEEL (Probable ubiquitin-conjugating enzyme E2 7 OS=Caenorhabditis elegans GN=ubc-7 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.201e-49
Identity = 90/150 (60.00%), Postives = 108/150 (72.00%), Query Frame = -3
Query:  270 DLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTAEXXXXXXXXXXXSPNDESPANVEAAKEWRDRRDDFKKKVGRCVRRSQE 719
            D+ + PV GFSAGLVD+ +I++W V +IGPPDTLYEGGFF AI+ FP +YP  PP +KF +EIWHPN+  +G VCISILH PGDD  GYE   ERW+PVHT E            PN ESPANV+AAK  R+   +FKKKV +CVRRSQE
Sbjct:   14 DMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKPPKMKFISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLSVISMLTDPNFESPANVDAAKMQRENYAEFKKKVAQCVRRSQE 163          
The following BLAST results are available for this feature:
BLAST of CN185891 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 155
Match NameE-valueIdentityDescription
UBC13_ARATH3.157e-7281.58Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis ... [more]
UBC7_ARATH5.385e-7280.92Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis t... [more]
UBC14_ARATH7.278e-6977.78Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis ... [more]
UBC7_WHEAT1.018e-6273.47Ubiquitin-conjugating enzyme E2 7 OS=Triticum aest... [more]
UBC15_SCHPO6.613e-5464.05Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccha... [more]
UB2G1_RAT2.600e-5060.26Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norve... [more]
UB2G1_MOUSE2.600e-5060.26Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus... [more]
UB2G1_HUMAN2.600e-5060.26Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens... [more]
UB2G1_MACFA1.686e-4959.60Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fasci... [more]
UBC7_CAEEL2.201e-4960.00Probable ubiquitin-conjugating enzyme E2 7 OS=Caen... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185891 ID=CN185891|Name=CN185891|organism=Citrus sinensis|type=EST|length=733bp
TTTTTTTTTTTTACTTAGAGAACGACAGAACATTTGTGACCAATTTTAAC
CAAAGAACGCTTTTGAATACATGGATGTTCCCCGTCGTTACAGTGACTTG
ACCATGCAGAGAAAACGAGAGAGATGGTTGAGAGAACTTCAAAATGCCAG
TCTACACAAGACCAAGTACCCACAGAACCCAGTTCCCCCCACGCGGTTAA
ATCAAGACATTTCCCGTACAAACACATAGGTAGAGAAAAAAAAGAGTGCC
TGCAGTTGGTTTACAACATTTCTTGTGATCTTCTCACACAGCGGCCTACT
TTCTTCTTGAAGTCATCTCTCCTGTCTCTCCATTCTTTTGCAGCTTCGAC
ATTTGCAGGAGATTCATCATTAGGACTGGAAAGCATTGATATGATACTCA
AAACGATACTTTCAGCAGTATGAACAGGCATCCAGCGCTCACTTGCGAGC
TCATATCCATTAGGGTCGTCACCTGGAGGATGAAGGATTGATATGCAGAC
ACGCCCATCCGGATAGACATTAGGATGCCAAATCTCTGTTGTAAACTTCA
CTGTAGGTGGGCTATTAGGGTAGTTTGATGGAAAGCTCATAATGGCATTG
AAAAATCCCCCCTCATAAAGAGTATCAGGTGGTCCAATAATTGTAACACT
CCATTCAAAGATATTTGTCTCATCCACCAACCCGGCAGAAAACCCAGCAA
CAGGGTTCTTACAAAGATCTTTTTAGTTGTTTT
back to top