DC900078

Overview
NameDC900078
Unique NameDC900078
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length391
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1470 contig Csv1_Contig1470:230..620. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP3_PRUDU (Non-specific lipid-transfer protein 3 OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.828e-18
Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 2
Query:    8 ARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            A++TADRQ++C CLKQAV+GI YT    GLAAGLPGKCG+NIPY+ISPSTDC  ++
Sbjct:   68 AQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSIK 123          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.452e-14
Identity = 38/58 (65.52%), Postives = 43/58 (74.14%), Query Frame = 2
Query:    2 NAARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            N+AR+T DRQ  CTCLK A   IS     LG AAGLP  CG+NIPY+ISPSTDCS+VQ
Sbjct:   59 NSARTTEDRQIACTCLKSAAGAIS--GINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ 114          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP2_TOBAC (Non-specific lipid-transfer protein 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.225e-14
Identity = 36/57 (63.16%), Postives = 44/57 (77.19%), Query Frame = 2
Query:    5 AARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            AA+S +DR+T CTCLK A + I      +G AAGLPG CG+NIPY+ISPSTDCS+VQ
Sbjct:   60 AAKSLSDRKTACTCLKSAANAIK--GIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ 114          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLPN (Non-specific lipid-transfer protein 2 OS=Solanum pennellii GN=LTP2 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.229e-13
Identity = 36/56 (64.29%), Postives = 42/56 (75.00%), Query Frame = 2
Query:    8 ARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            A++T DRQT CTCLK A S  S+T   LG AA LP  C +NIPY+ISPSTDCS+VQ
Sbjct:   61 AQTTVDRQTACTCLKSAAS--SFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKVQ 114          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.229e-13
Identity = 35/58 (60.34%), Postives = 43/58 (74.14%), Query Frame = 2
Query:    2 NAARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            NAA++TADRQ  C CLK A + I      L LAAGLPGKCG+++PY+ISPSTDC  V+
Sbjct:   36 NAAKTTADRQAACNCLKSAFNSIK--GLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP4_ORYSJ (Non-specific lipid-transfer protein 4 OS=Oryza sativa subsp. japonica GN=Os12g0114500 PE=3 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 3.577e-13
Identity = 36/57 (63.16%), Postives = 41/57 (71.93%), Query Frame = 2
Query:    2 NAARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRV 172
            +AA +TADRQT C CLKQ  S +   R  L   AG+P KCG+NIPY ISPSTDCSRV
Sbjct:   64 SAAATTADRQTTCACLKQQTSAMGGLRPDL--VAGIPSKCGVNIPYAISPSTDCSRV 118          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP_DAUCA (Non-specific lipid-transfer protein OS=Daucus carota GN=EP2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.672e-13
Identity = 33/57 (57.89%), Postives = 43/57 (75.44%), Query Frame = 2
Query:    2 NAARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRV 172
            NAAR+T D++T C CLKQ  + +  T   L  AAGLP +CG+NIPY+ISP+TDC+RV
Sbjct:   65 NAARTTLDKRTACGCLKQTANAV--TGLNLNAAAGLPARCGVNIPYKISPTTDCNRV 119          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP2_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.672e-13
Identity = 34/58 (58.62%), Postives = 44/58 (75.86%), Query Frame = 2
Query:    2 NAARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            +AA++T  RQ  C C+K A +GI  T    GLA+GLPGKCG+NIPY+ISPSTDC+ V+
Sbjct:   65 SAAQTTPVRQAACRCIKSAAAGI--TGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 120          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.672e-13
Identity = 34/58 (58.62%), Postives = 44/58 (75.86%), Query Frame = 2
Query:    2 NAARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            +AA++T  RQ  C C+K A +GI  T    GLA+GLPGKCG+NIPY+ISPSTDC+ V+
Sbjct:   61 SAAQTTPVRQAACRCIKSAAAGI--TGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 116          
BLAST of DC900078 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLLC (Non-specific lipid-transfer protein 2 OS=Solanum lycopersicum GN=LE16 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.041e-12
Identity = 35/57 (61.40%), Postives = 41/57 (71.93%), Query Frame = 2
Query:    5 AARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ 175
            AA++  DR+T CTCLK A + I       G AAGLPG CG+NIPY+ISPSTDCS VQ
Sbjct:   60 AAKTPEDRKTACTCLKSAANSIK--GIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114          
The following BLAST results are available for this feature:
BLAST of DC900078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
NLTP3_PRUDU2.828e-1869.64Non-specific lipid-transfer protein 3 OS=Prunus du... [more]
NLTP1_TOBAC1.452e-1465.52Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLTP2_TOBAC4.225e-1463.16Non-specific lipid-transfer protein 2 OS=Nicotiana... [more]
NLTP2_SOLPN1.229e-1364.29Non-specific lipid-transfer protein 2 OS=Solanum p... [more]
LTP1_MORNI1.229e-1360.34Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP4_ORYSJ3.577e-1363.16Non-specific lipid-transfer protein 4 OS=Oryza sat... [more]
NLTP_DAUCA4.672e-1357.89Non-specific lipid-transfer protein OS=Daucus caro... [more]
NLTP2_GOSHI4.672e-1358.62Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP1_GOSHI4.672e-1358.62Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP2_SOLLC1.041e-1261.40Non-specific lipid-transfer protein 2 OS=Solanum l... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900078 VSS Citrus sinensis cDNA clone VS27Q84 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900078 ID=DC900078|Name=DC900078|organism=Citrus sinensis|type=EST|length=391bp
CAATGCCGCTCGGTCCACAGCTGACCGTCAGACCGTGTGTACGTGCTTGA
AACAAGCTGTCAGTGGAATCTCGTACACCAGGTACCAGCTCGGACTCGCA
GCTGGACTTCCCGGCAAATGTGGACTCAACATTCCTTACCAGATCAGCCC
TTCTACTGACTGCAGCAGGGTGCAGTGAGAATGATGAACTAGTAGCCATC
AGTTATGACGCTGTGTGCTTGGATAATTAAGCATGGGGTGAGAGAATAAG
AGTGCTGCGCTTCTGTTTGATGGTGTGTTAGTGTTAAATAGAAGTTGTTA
GCGTCATCTGGTGGGATTTATGTTGTCTCATGTTTTGTTAGGTTCTGTCC
CAACCATAAGTACTAAAGAATAAGATTTTGTAAGTTACGTT
back to top