CN185884

Overview
NameCN185884
Unique NameCN185884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length739
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.123e-23
Identity = 46/66 (69.70%), Postives = 54/66 (81.82%), Query Frame = 2
Query:   77 MSDTCGNCDCADRNQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 274
            MSDTCGNCDCAD+ QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.686e-18
Identity = 38/64 (59.38%), Postives = 48/64 (75.00%), Query Frame = 2
Query:   86 TCGNCDCADRNQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 277
            TCGNCDC D++QCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.508e-18
Identity = 43/65 (66.15%), Postives = 49/65 (75.38%), Query Frame = 2
Query:   77 MSDTCGNCDCADRNQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 271
            MSD CGNCDCAD +QCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.600e-16
Identity = 37/65 (56.92%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   77 MSDTCGNCDCADRNQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 271
            MS  C NCDC+D +QC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.600e-16
Identity = 39/66 (59.09%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   77 MSDTCGNCDCADRNQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 274
            MS  C NCDCAD  QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.630e-15
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   77 MSDTCGNCDCADRNQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 274
            MSD CGNCDCAD++QCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.630e-15
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   77 MSDTCGNCDCADRNQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 274
            MSD CGNCDCAD++QCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: UBIQ_WHEAT (Ubiquitin OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.192e-15
Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  620 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ 739
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ 40          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: UBIQ_SOYBN (Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.192e-15
Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  620 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ 739
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ 40          
BLAST of CN185884 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLTU (Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.192e-15
Identity = 40/40 (100.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  620 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ 739
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ 40          
The following BLAST results are available for this feature:
BLAST of CN185884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
MT3_CARPA2.123e-2369.70Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC2.686e-1859.38Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE3.508e-1866.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV5.600e-1656.92Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO5.600e-1659.09Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ3.630e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI3.630e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
UBIQ_WHEAT6.192e-15100.00Ubiquitin OS=Triticum aestivum PE=3 SV=1[more]
UBIQ_SOYBN6.192e-15100.00Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1[more]
UBIQ_SOLTU6.192e-15100.00Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1[more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A06_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185884 ID=CN185884|Name=CN185884|organism=Citrus sinensis|type=EST|length=739bp
AGGAGCAAAGCAAGTTTCGTACAATAAAGAGCCCTCTATTTCCAGTTTTA
AATTCCAAGTTCTAAGCTCAATCAACATGTCGGACACCTGCGGCAACTGC
GACTGCGCTGACAGGAACCAGTGTGTGAAGAAGGGAAGCAGCTATGCTGC
TGACTTCGTCGAGACTGACTTGAGCTTTGTCAGCACCGTTGTTGTCATGG
ACGTTCAGGCTGCTGAGACTGAAGGTAACTGCAAGTGCGGCCCCACCTGC
GCTTGTGTGAACTGCACTTGTGGTAGTCACTAATAAGCAAACACATGCAG
CAAAAAATAAGAAGCTGCAAGTGTGCCTAAATATTGTGGGGGTTAAGAAT
AATGTAAGGGTGATTAAAAAAAAAGAAAAATTCTCTACTTCGTTTTTATG
ATGGTCTACTACTAGTGTGTGGAGTGATGTGCGTGTTGTGTCACCCATCA
CTCGTAATGTTTTGTGTTTCCTTCTTCATAATCATGTAATATATGGCCAT
GGCCATGACCGTGGCCTTGTGTGGTTTAATTTTAATGTATTATTGTTAGC
CGCACCCTTGCCGACTATAACATTCAGAAGGAGTCCACCCTCCACCTGGT
CCTCCGTCTAAGAGGTGGAATGCAGATATTTGTGAAAACCCTGACTGGTA
AAACTATCACCTTGGAAGTTGAGAGTTCTGATACAATCGACAATGTCAAG
GCTAAGATTCAGGACAAGGAGGGAATCCCTCCTGATCAG
back to top