CN185882

Overview
NameCN185882
Unique NameCN185882
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length638
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2605 contig Csv1_Contig2605:106..737. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.523e-56
Identity = 104/116 (89.66%), Postives = 112/116 (96.55%), Query Frame = 3
Query:   93 AAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATAS 440
            AAEEGQVIGCHTVEAWNEQLQK N+TK L+VVDFTASWCGPCRFIAPFLAELAKKLPNV FLKVDVDELK+VA +WAVE+MPTFMFLKEGKI+DKVVGAKK+ELQQTIAKH+ATAS
Sbjct:    2 AAEEGQVIGCHTVEAWNEQLQKGNDTKGLIVVDFTASWCGPCRFIAPFLAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHMATAS 117          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.351e-53
Identity = 98/113 (86.73%), Postives = 107/113 (94.69%), Query Frame = 3
Query:   93 AAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLA 431
            A+EEGQVI CHTVE WNEQLQK+NE+K LVVVDFTASWCGPCRFIAPF A+LAKKLPNVLFLKVD DELKSVA+DWA++AMPTFMFLKEGKI+DKVVGAKK+ELQ TIAKHLA
Sbjct:    2 ASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA 114          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.655e-50
Identity = 95/115 (82.61%), Postives = 105/115 (91.30%), Query Frame = 3
Query:   96 AEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATAS 440
            AEEGQVIG HTV+AWNE LQK  + K+L+VVDFTASWCGPC+FIA F AELAKK+P V FLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKK+ELQQTIAKH+++ S
Sbjct:    2 AEEGQVIGVHTVDAWNEHLQKGIDDKKLIVVDFTASWCGPCKFIASFYAELAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISSTS 116          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.364e-46
Identity = 85/119 (71.43%), Postives = 104/119 (87.39%), Query Frame = 3
Query:   84 EMAAAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATAS 440
            +  ++EEGQV GCH VE WNE  +K  ETK+LVVVDFTASWCGPCRFIAP LA++AKK+P+V+FLKVDVDELK+V+ +W+VEAMPTF+F+K+GK VD+VVGAKKEELQQTI KH A A+
Sbjct:    5 DATSSEEGQVFGCHKVEEWNEYFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHAAPAT 123          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH5_ARATH (Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TRX5 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.045e-38
Identity = 68/110 (61.82%), Postives = 93/110 (84.55%), Query Frame = 3
Query:   96 AEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKH 425
            A EG+VI CHT+E WNE+++ +NE+K+L+V+DFTASWC PCRFIAP  AE+AKK  NV+F K+DVDEL++VA ++ VEAMPTF+F+KEG I+D+VVGA K+E+ + + KH
Sbjct:    2 AGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSJ (Thioredoxin H-type OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.182e-36
Identity = 70/117 (59.83%), Postives = 89/117 (76.07%), Query Frame = 3
Query:   93 AAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATASA 443
            AAEEG VI CH  + ++ Q+ K+ E  ++V++DFTASWCGPCRFIAP  AE AKK P  +FLKVDVDELK VA  + VEAMPTF+F+K+G   DKVVGA+K++LQ TI KH+   +A
Sbjct:    2 AAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAA 118          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSI (Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.182e-36
Identity = 70/117 (59.83%), Postives = 89/117 (76.07%), Query Frame = 3
Query:   93 AAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATASA 443
            AAEEG VI CH  + ++ Q+ K+ E  ++V++DFTASWCGPCRFIAP  AE AKK P  +FLKVDVDELK VA  + VEAMPTF+F+K+G   DKVVGA+K++LQ TI KH+   +A
Sbjct:    2 AAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAA 118          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH2_BRANA (Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.182e-36
Identity = 70/118 (59.32%), Postives = 93/118 (78.81%), Query Frame = 3
Query:   93 AAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKK-LPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATASA 443
            AAEEGQVIGCH ++ W  QL  + ++ +L+V+DFTASWC PCR IAP  A+LAKK + + +F KVDVDEL++VA ++ VEAMPTF+ +K+G +VDKVVGA+KE+L  TIAKH   A+A
Sbjct:    2 AAEEGQVIGCHEIDVWAVQLDTAKQSNKLIVIDFTASWCPPCRMIAPVFADLAKKFMSSAIFFKVDVDELQNVAQEFGVEAMPTFVLIKDGNVVDKVVGARKEDLHATIAKHTGVATA 119          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.850e-36
Identity = 67/110 (60.91%), Postives = 90/110 (81.82%), Query Frame = 3
Query:   96 AEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKH 425
            AEE QVI CHTV+ WNE+ QK+ ++ +L+V+DFTASWCGPCR I P+++ELAKK P+V F KVDVD+LK VA ++ VEAMP+F+ LKEG+ V+++VGA+K+EL   IA H
Sbjct:    2 AEEAQVIACHTVQEWNEKFQKAKDSGKLIVIDFTASWCGPCRVITPYVSELAKKFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKIAVH 111          
BLAST of CN185882 vs. ExPASy Swiss-Prot
Match: TRXH4_ARATH (Thioredoxin H-type 4 OS=Arabidopsis thaliana GN=TRX4 PE=2 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 2.850e-36
Identity = 71/118 (60.17%), Postives = 91/118 (77.12%), Query Frame = 3
Query:   93 AAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKK-LPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAKHLATASA 443
            AAEEGQVIGCHT + W  QL K+ E+ +L+V+DFTASWC PCR IAP   +LAKK + + +F KVDVDEL+SVA ++ VEAMPTF+F+K G++VDK+VGA KE+LQ  I KH    +A
Sbjct:    2 AAEEGQVIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTGVTTA 119          
The following BLAST results are available for this feature:
BLAST of CN185882 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
TRXH_RICCO5.523e-5689.66Thioredoxin H-type OS=Ricinus communis PE=3 SV=1[more]
TRXH1_ARATH3.351e-5386.73Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TR... [more]
TRXH2_TOBAC2.655e-5082.61Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=... [more]
TRXH1_TOBAC1.364e-4671.43Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=... [more]
TRXH5_ARATH3.045e-3861.82Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TR... [more]
TRXH_ORYSJ2.182e-3659.83Thioredoxin H-type OS=Oryza sativa subsp. japonica... [more]
TRXH_ORYSI2.182e-3659.83Thioredoxin H-type OS=Oryza sativa subsp. indica G... [more]
TRXH2_BRANA2.182e-3659.32Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE... [more]
TRXH_FAGES2.850e-3660.91Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV... [more]
TRXH4_ARATH2.850e-3660.17Thioredoxin H-type 4 OS=Arabidopsis thaliana GN=TR... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A05_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185882 ID=CN185882|Name=CN185882|organism=Citrus sinensis|type=EST|length=638bp
CGCAAATCACCCGATTAAGAAAGCGAGGGAGAGAATAGAAGTATCGTTGG
GCGTAGTAGTGGTGGTAATAACCGCGGAAAGCAGAAATGGCAGCAGCAGA
AGAGGGACAAGTCATCGGGTGCCACACCGTTGAGGCCTGGAACGAGCAGC
TCCAGAAGAGCAATGAAACCAAACAGCTGGTTGTTGTTGATTTCACTGCT
TCATGGTGCGGACCATGCCGTTTCATTGCTCCTTTCTTGGCAGAGCTGGC
CAAGAAACTGCCTAATGTCCTGTTTCTGAAGGTTGATGTGGATGAACTGA
AGAGTGTTGCCACTGACTGGGCAGTGGAGGCCATGCCAACTTTCATGTTC
CTGAAAGAGGGGAAGATTGTGGACAAGGTGGTTGGAGCAAAGAAAGAGGA
ACTGCAGCAGACTATTGCCAAGCATCTGGCAACTGCTTCTGCCTAATAAG
TTATAACTATCCTCCTGCCTTTTGGCTTTAGAGGCTATAGACCTCAATAT
ATGCTATCAGTCTGTAATTTACTTATTAGAGTGGTTATGGGATTGTGTTT
GTTTGTGTGTTTTGAATATTCCGTAATTTACTGTTCTATGAAGCTCATAC
TGTGGTCTTTACAATNNANNANAAAAAAAAAAAAAAAA
back to top