DC900074

Overview
NameDC900074
Unique NameDC900074
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length704
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900074_ssr10 microsatellite DC900074_ssr10:10..41. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5635 contig Csv1_Contig5635:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_ARATH (3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Arabidopsis thaliana GN=At2g45300 PE=2 SV=3)

HSP 1 Score: 292.738 bits (748), Expect = 1.246e-78
Identity = 145/213 (68.08%), Postives = 157/213 (73.71%), Query Frame = 2
Query:   65 GNLSYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXXGNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMNK 703
            GN SY+LDGVPRMRERPIGDLV GLKQLGADV+C LGTNCPPVR+N                  QY            G+VEIEI+DKLISVPYVEMTLKLMERFGV VEH DSWDRFF++GGQKYKSPGNA+VEGDASSASYF             EGCGT+SLQGDVKFAE LEKMG K +WTEN VTVTGPPRD +G   LRA+DVNMNK
Sbjct:  192 GNASYVLDGVPRMRERPIGDLVVGLKQLGADVECTLGTNCPPVRVNANGGLPGGKVKLSGSISSQYLTALLMSAPLALGDVEIEIVDKLISVPYVEMTLKLMERFGVSVEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVEGCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNK 404          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_BRANA (3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Brassica napus PE=3 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.800e-77
Identity = 145/213 (68.08%), Postives = 155/213 (72.77%), Query Frame = 2
Query:   65 GNLSYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXXGNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMNK 703
            GN SY+LDGVPRMRERPIGDLV GLKQLGADV+C LGTNCPPVR+N                  QY            G+VEIEIIDKLISVPYVEMTLKLMERFGV  EH DSWDRFF++GGQKYKSPGNA+VEGDASSASYF             EGCGT+SLQGDVKFAE LEKMG K +WTEN VTVTGP RD +G   LRAVDVNMNK
Sbjct:  188 GNASYVLDGVPRMRERPIGDLVVGLKQLGADVECTLGTNCPPVRVNANGGLPGGKVKLSGSISSQYLTALLMAAPLALGDVEIEIIDKLISVPYVEMTLKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVEGCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNK 400          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_SOLLC (3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 5.419e-74
Identity = 142/213 (66.67%), Postives = 151/213 (70.89%), Query Frame = 2
Query:   65 GNLSYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXXGNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMNK 703
            G+  Y+LDGVPRMRERPIGDLV GLKQLGA+VDC LGTNCPPVRI                   QY            G+VEIEIIDKLISVPYVEMTLKLMERFGVFVEH   WDRF ++GGQKYKSPG AFVEGDASSASYF             EGCGTSSLQGDVKFAE LEKMGA+ TWTEN VTV GPPR+  G   LRA+DVNMNK
Sbjct:  192 GHSRYVLDGVPRMRERPIGDLVDGLKQLGAEVDCSLGTNCPPVRIVSKGGLPGGKVKLSGSISSQYLTALLMAAPLALGDVEIEIIDKLISVPYVEMTLKLMERFGVFVEHSSGWDRFLVKGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTVTVEGCGTSSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNK 404          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_PETHY (3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Petunia hybrida PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 9.243e-74
Identity = 141/213 (66.20%), Postives = 150/213 (70.42%), Query Frame = 2
Query:   65 GNLSYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXXGNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMNK 703
            GN  Y+LDGVPRMRERPI DLV GLKQLGA+VDC LGT CPPVRI                   QY            G+VEIEIIDKLISVPYVEMTLKLMERFG+ VEH  SWDRFF++GGQKYKSPG AFVEGDASSASYF             EGCGT+SLQGDVKFAE LEKMGA+ TWTEN VTV GPPR   GR  LRA+DVNMNK
Sbjct:  188 GNSRYVLDGVPRMRERPISDLVDGLKQLGAEVDCFLGTKCPPVRIVSKGGLPGGKVKLSGSISSQYLTALLMAAPLALGDVEIEIIDKLISVPYVEMTLKLMERFGISVEHSSSWDRFFVRGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTITVEGCGTNSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRSSSGRKHLRAIDVNMNK 400          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA1_TOBAC (3-phosphoshikimate 1-carboxyvinyltransferase 1, chloroplastic OS=Nicotiana tabacum GN=EPSPS-1 PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 5.991e-73
Identity = 141/213 (66.20%), Postives = 151/213 (70.89%), Query Frame = 2
Query:   65 GNLSYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXXGNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMNK 703
            G+  Y+LDGVPRMRERPIGDLV GLKQLGA+VDC LGTNCPPVRI                   QY            G+VEIEIIDKLISVPYVEMTLKLMERFGV VEH  SWD+F ++GGQKYKSPG A+VEGDASSASYF             EGCGTSSLQGDVKFAE LEKMGA+ TWTEN VTV GPPR+  G   LRAVDVNMNK
Sbjct:  190 GHSRYVLDGVPRMRERPIGDLVDGLKQLGAEVDCFLGTNCPPVRIVSKGGLPGGKVKLSGSISSQYLTALLMAAPLALGDVEIEIIDKLISVPYVEMTLKLMERFGVSVEHTSSWDKFLVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVEGCGTSSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRNSSGMKHLRAVDVNMNK 402          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA2_TOBAC (3-phosphoshikimate 1-carboxyvinyltransferase 2 (Fragment) OS=Nicotiana tabacum GN=EPSPS-2 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 9.565e-71
Identity = 137/213 (64.32%), Postives = 148/213 (69.48%), Query Frame = 2
Query:   65 GNLSYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXXGNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMNK 703
            GN  Y+LDGVPRMRERPIGDLV GLKQLGA+VDC LGT CPPVRI                   QY            G+VEIEIIDKLISV YVEMTLKLMERFG+ VEH  SWDRF ++GGQKYKSPG A+VEGDASSASYF             EGCGTSSLQGDVKFAE LE+MGA+ TWTEN VTV GPPR+      LRA+DVNMNK
Sbjct:   10 GNSRYVLDGVPRMRERPIGDLVDGLKQLGAEVDCFLGTKCPPVRIVSKGGLPGGKVKLSGSISSQYLTALLMAAPLALGDVEIEIIDKLISVLYVEMTLKLMERFGISVEHSSSWDRFVVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVEGCGTSSLQGDVKFAEVLEQMGAEVTWTENSVTVKGPPRNSSAMKHLRAIDVNMNK 222          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_RALEJ (3-phosphoshikimate 1-carboxyvinyltransferase OS=Ralstonia eutropha (strain JMP134) GN=aroA PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.434e-36
Identity = 87/211 (41.23%), Postives = 114/211 (54.03%), Query Frame = 2
Query:   77 YILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXX---GNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMN 700
            Y L GVPRM ERPIGDLV GL+Q+GAD+  +     PP+ I                   Q+               G +EIE++ +LIS PY+E+TL L+ RFG+ VE    W+RF +  G  Y+SPG  +VEGDASSASYF             EG G SS+QGDV+FAE L +MGA     +N + V G  RD  GR  L  ++++ N
Sbjct:  110 YKLSGVPRMHERPIGDLVDGLRQVGADIGYLANEGFPPLHIRPAQIRIDAPIRVRGDVSSQFLTALLMTLPMAQAANGKIEIEVVGELISKPYIEITLNLLARFGINVER-QGWERFIVPAGAVYRSPGEIYVEGDASSASYFLAAGAIGGGPVRVEGVGMSSIQGDVRFAEALNRMGANVMAGDNWIEVRGTERDD-GR--LHGIELDCN 316          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_CUPTR (3-phosphoshikimate 1-carboxyvinyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aroA PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 9.991e-36
Identity = 87/212 (41.04%), Postives = 115/212 (54.25%), Query Frame = 2
Query:   74 SYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXX---GNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMN 700
            SY L GVPRM ERPIGDLV GL+Q+GA +D +     PP+ I                   Q+               G +EIE++ +LIS PY+E+TL L+ RFG+ VE    W+RF +  G  Y+SPG  FVEGDASSASYF             EG G +S+QGDV+FA+ L +MGA     +N + V G  RD  GR  L  ++++ N
Sbjct:  109 SYKLSGVPRMHERPIGDLVDGLRQVGAVIDYLGNEGFPPLHIQPASLRIDAPIRVRGDVSSQFLTALLMSLPLAQSASGRIEIEVVGELISKPYIEITLNLLARFGIEVER-QGWERFILPAGTAYRSPGEIFVEGDASSASYFLAAGAIGGGPVRVEGVGMASIQGDVRFADALNRMGANVMAGDNWIEVRGTERDD-GR--LHGIELDCN 316          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_RALEH (3-phosphoshikimate 1-carboxyvinyltransferase OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroA PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.704e-35
Identity = 86/212 (40.57%), Postives = 115/212 (54.25%), Query Frame = 2
Query:   74 SYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXX---GNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMN 700
            +Y L GVPRM ERPIGDLV GL+Q+GA +D +     PP+ I                   Q+               G +EIE++ +LIS PY+E+TL L+ RFG+ +E    W+RF +  G  Y+SPG  FVEGDASSASYF             EG G +S+QGDV+FAE L +MGA     +N + V G  RD  GR  L  ++++ N
Sbjct:  109 NYKLSGVPRMHERPIGDLVDGLRQVGAVIDYLGNEGFPPLHIQPAGIRIDAPIRVRGDVSSQFLTALLMSLPMAQSDSGRIEIEVVGELISKPYIEITLNLLARFGIEIER-QGWERFVLPAGAAYRSPGEIFVEGDASSASYFLAAGAIGGGPVRVEGVGMASIQGDVRFAEALNRMGANVMAGDNWIEVRGTERDD-GR--LHGIELDCN 316          
BLAST of DC900074 vs. ExPASy Swiss-Prot
Match: AROA_ENTS8 (3-phosphoshikimate 1-carboxyvinyltransferase OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=aroA PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.884e-34
Identity = 85/212 (40.09%), Postives = 118/212 (55.66%), Query Frame = 2
Query:   65 GNLSYILDGVPRMRERPIGDLVTGLKQLGADVDCILGTNCPPVRINXXXXXXXXXXXXXXXXXXQYXXXXXXXXXXXXGNVEIEIIDKLISVPYVEMTLKLMERFGVFVEHGDSWDRFFIQGGQKYKSPGNAFVEGDASSASYFXXXXXXXXXXXXXEGCGTSSLQGDVKFAEXLEKMGAKXTWTENXVTVTGPPRDPYGRNPLRAVDVNMN 700
            G  + +L G PRM+ERPIG LV  L+Q GADV  +   N PP+ +                   Q+            GN  I+I  +L+S PY+++TL LM+ FGV VE+  ++ RF IQGGQ+Y+SPG+  VEGDASSASYF              G G +S+QGD++FA+ LEKMGA  TW ++ ++ T        R  L A+D++MN
Sbjct:  110 GTNNVVLTGEPRMKERPIGHLVDALRQGGADVTYLEQENYPPLHLKGGFTGGNVTVDGSVSS--QFLTALLMAAPLAPGNTAIDIKGELVSKPYIDITLHLMKTFGVEVEN-QNYQRFVIQGGQQYQSPGHYLVEGDASSASYFLAAAAIKGGTVKVTGIGRNSVQGDIRFADVLEKMGAHITWGDDFISCT--------RGELNAIDMDMN 310          
The following BLAST results are available for this feature:
BLAST of DC900074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 190
Match NameE-valueIdentityDescription
AROA_ARATH1.246e-7868.083-phosphoshikimate 1-carboxyvinyltransferase, chlo... [more]
AROA_BRANA1.800e-7768.083-phosphoshikimate 1-carboxyvinyltransferase, chlo... [more]
AROA_SOLLC5.419e-7466.673-phosphoshikimate 1-carboxyvinyltransferase, chlo... [more]
AROA_PETHY9.243e-7466.203-phosphoshikimate 1-carboxyvinyltransferase, chlo... [more]
AROA1_TOBAC5.991e-7366.203-phosphoshikimate 1-carboxyvinyltransferase 1, ch... [more]
AROA2_TOBAC9.565e-7164.323-phosphoshikimate 1-carboxyvinyltransferase 2 (Fr... [more]
AROA_RALEJ3.434e-3641.233-phosphoshikimate 1-carboxyvinyltransferase OS=Ra... [more]
AROA_CUPTR9.991e-3641.043-phosphoshikimate 1-carboxyvinyltransferase OS=Cu... [more]
AROA_RALEH1.704e-3540.573-phosphoshikimate 1-carboxyvinyltransferase OS=Ra... [more]
AROA_ENTS81.884e-3440.093-phosphoshikimate 1-carboxyvinyltransferase OS=En... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900074 VSS Citrus sinensis cDNA clone VS27Q80 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900074 ID=DC900074|Name=DC900074|organism=Citrus sinensis|type=EST|length=704bp
CTCGTGCCGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCCTCGTGCC
GAATTCGGCACGAGGGCAACTTGAGCTATATCCTTGATGGGGTGCCTCGA
ATGAGGGAGAGACCAATTGGAGACTTGGTCACTGGTCTGAAGCAGCTAGG
TGCAGATGTAGATTGCATTTTAGGCACAAATTGCCCCCCTGTTCGTATCA
ATGGAAAGGGAGGCCTCCCTGGGGGAAAGGTGAAACTCTCTGGAAAGCTT
AGTAGTCAATACTTGACTGCTTTGCTCATGGCAGCTCCCTTGGCCCTCGG
AAATGTGGAAATTGAAATAATTGATAAACTGATTTCCGTTCCTTATGTTG
AGATGACTCTGAAGTTGATGGAGCGTTTTGGGGTCTTTGTAGAGCACGGT
GATAGCTGGGATCGGTTCTTCATCCAGGGGGGTCAAAAGTACAAGTCTCC
TGGAAATGCTTTTGTAGAAGGTGATGCTTCAAGTGCTAGTTACTTTGTAG
CTGGTGCTGCAGTAACTGGTGGGACCGTTACAGTTGAAGGTTGTGGGACA
AGTAGTTTACAGGGGGATGTGAAATTTGCTGAGGNTCTTGAGAAAATGGG
TGCCAAAGNTACCTGGACTGAAAACAGNGTAACTGTCACCGGACCACCAC
GAGATCCTTATGGAAGGAACCCTTTGCGTGCTGTAGATGTCAACATGAAC
AAAT
back to top