CN185880

Overview
NameCN185880
Unique NameCN185880
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length712
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DERL1_ARATH (Derlin-1 OS=Arabidopsis thaliana GN=DER1 PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 2.231e-83
Identity = 153/215 (71.16%), Postives = 170/215 (79.07%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVARWRIGAPAINRAQ--------------------------PERTTGVAFRGRSYRLSD 689
            +WRLITN FFLG FSINFGIRLLMIARYGV LEKGPFERRTADFLWMMIFG+ +LLVLS IP F + FLG+SLVFML+Y+WSREFPN+ I++YGLVTLKAFYLPWAMLALDVIFGSP++PDLLGIIAGHLYYFLTVLHPLATGKN LKTPKWV K+VARWRIGAP  +  Q                          P  ++  AFRGRSYRL+D
Sbjct:   52 IWRLITNLFFLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFLGVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGHLYYFLTVLHPLATGKNYLKTPKWVNKIVARWRIGAPVASVRQAGGVGAAGPGAGGGVGGGGAYSSARAPPESSNTAFRGRSYRLTD 266          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DERL1_ORYSJ (Derlin-1 OS=Oryza sativa subsp. japonica GN=DER1 PE=2 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 2.236e-75
Identity = 138/190 (72.63%), Postives = 157/190 (82.63%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVARWRIGAPAINRAQP--ERTTGVAFRGRSYRLS 686
            +WRL T+FFFLG FSINFGIRLLMIARYGV LEKG FE+RTADFLWMMIFGA+SLL LSAIP    YFLG+ +V ML+YVWSRE+PNSQI++YGLV L++FYLPWAML LDVIFGS ++P LLGI+ GH YYFL+VLHPLATGKN LKTP WV K+VAR+RIG  A    +P    T   AFRGRSYRLS
Sbjct:   52 IWRLFTSFFFLGKFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAIPFLDIYFLGVPMVSMLLYVWSREYPNSQISMYGLVQLRSFYLPWAMLGLDVIFGSEILPGLLGILVGHTYYFLSVLHPLATGKNYLKTPMWVHKIVARFRIGVQANAPVRPAAANTGSGAFRGRSYRLS 241          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DER12_MAIZE (Derlin-1.2 OS=Zea mays GN=DER1.2 PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.893e-74
Identity = 140/192 (72.92%), Postives = 157/192 (81.77%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVARWRIG----APAINRAQPERTTGVAFRGRSYRLS 686
            VWR+ T+FFFLG FSINFGIRLLMIARYGV LEKG F++RTADFLWMMIFGA+SLLVLS IP   +Y LG+ +V MLVYVWSRE PN+QINIYG++ LKAFYLPW ML LDVIFGSPL+P LLGI+ GHLYY+  VLHPLATGKN LKTPKWV K+VAR+RIG    AP    A     TG AFRGRSYRL+
Sbjct:   52 VWRIFTSFFFLGPFSINFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSVIPQLNTYVLGLPMVSMLVYVWSRENPNAQINIYGILQLKAFYLPWVMLLLDVIFGSPLMPGLLGIMVGHLYYYFAVLHPLATGKNYLKTPKWVHKIVARFRIGMQANAPVRAPANGNAGTG-AFRGRSYRLN 242          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DER11_MAIZE (Derlin-1.1 OS=Zea mays GN=DER1.1 PE=2 SV=2)

HSP 1 Score: 276.174 bits (705), Expect = 1.227e-73
Identity = 137/192 (71.35%), Postives = 160/192 (83.33%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVARWRIGAPAINRAQPERT----TGVAFRGRSYRLS 686
            +WRL+T+FFFL  FS+ FGIRLLMIARYGV LEKG F++RTADFLWMMIFGA+SLLVLS IP+F S+FLGI +V ML+YVWSRE PN+QINIYGLV L++FYLPWAML LDVIFGS L+P LLGI+ GHLYYF  VLHPLATGK+ LKTPKWV K+VAR+RIG  A +  +P       +GV FRGRSYRL+
Sbjct:   52 IWRLLTSFFFLAPFSMKFGIRLLMIARYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIPLFNSFFLGIPMVSMLLYVWSRENPNAQINIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGHLYYFFAVLHPLATGKSYLKTPKWVHKIVARFRIGMQANSPVRPPANGNSGSGV-FRGRSYRLN 242          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DERL3_BOVIN (Derlin-3 OS=Bos taurus GN=DERL3 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.373e-32
Identity = 70/158 (44.30%), Postives = 102/158 (64.56%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHP-LATGKNLLKTPKWVQKLV 593
            VWRLITNF F G    +F   +L + RY   LE+G F  RTADF++M +FG + + +L  +     +FLG +L  MLVYVWSR  P  ++N +GL+T +A +LPWA++ L ++ G+ ++ DLLGI  GH+YYFL  + P    GK LL TP +++ L+
Sbjct:   54 VWRLITNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSL--FFLGQALTAMLVYVWSRRSPGVRVNFFGLLTFQAPFLPWALMGLPMLLGNSILVDLLGIAVGHVYYFLEDVFPNQPGGKRLLLTPSFLKLLL 209          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DERL3_HUMAN (Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 1.793e-32
Identity = 68/158 (43.04%), Postives = 103/158 (65.19%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHP-LATGKNLLKTPKWVQKLV 593
            VWRL+TNF F G    +F   +L + RY   LE+G F  RTADF++M +FG + + +L  +     +FLG +L+ MLVYVWSR  P  ++N +GL+T +A +LPWA++   ++ G+ ++ DLLGI  GH+YYFL  + P    GK LL+TP +++ L+
Sbjct:   54 VWRLVTNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSL--FFLGQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFLKLLL 209          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DERL2_DICDI (Probable derlin-2 homolog OS=Dictyostelium discoideum GN=derl2 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.058e-32
Identity = 68/161 (42.24%), Postives = 96/161 (59.63%), Query Frame = 3
Query:  126 WRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIF-----RSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLV 593
            WRL TNFFF     +NF   +  + R+   LE+  F  R+AD+L+M IFG+  LL++ A   +     +  FL  S+ FM++YVWSR  PN  I+  GL T  A YLPW +L +  +F   L  DLLG +AGH YYFL   +PL + + LLKTP +++ L+
Sbjct:   54 WRLFTNFFFYDEIGMNFFFHMYFLVRHSRLLEESSFRGRSADYLFMWIFGSFLLLIMDAFLFYTKIVTKVLFLAPSIAFMVIYVWSRRNPNMHISFLGLFTFSAPYLPWVILIMGYLFNHDLTTDLLGAVAGHAYYFLEDAYPLISNRRLLKTPGFLKNLM 214          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DERL2_ORYSJ (Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 71/167 (42.51%), Postives = 98/167 (58.68%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSL----LVLSAIPIF-----RSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVA 596
            +WRL+TNF +     ++F   +  +ARY   LE+  F  RTADF +M++FGA  L    L+   IP       R  FL  SL FM+VYVWS+  P   ++  GL T  A YLPW +L   ++ GS    DLLG+IAGH+YYFL  ++P  TG+  LKTP +++ L A
Sbjct:   53 IWRLVTNFLYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIGGMIPYISETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFA 219          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DER22_MAIZE (Derlin-2.2 OS=Zea mays GN=DER2.2 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 71/167 (42.51%), Postives = 98/167 (58.68%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSL----LVLSAIPIF-----RSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVA 596
            +WRL+TNF +     ++F   +  +ARY   LE+  F  RTADF +M++FGA  L    L+   IP       R  FL  SL FM+VYVWS+  P   ++  GL T  A YLPW +L   ++ GS    DLLG+IAGH+YYFL  ++P  TG+  LKTP +++ L A
Sbjct:   53 IWRLVTNFLYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIGGMIPYISETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFA 219          
BLAST of CN185880 vs. ExPASy Swiss-Prot
Match: DER21_MAIZE (Derlin-2.1 OS=Zea mays GN=DER2.1 PE=2 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.589e-31
Identity = 71/167 (42.51%), Postives = 98/167 (58.68%), Query Frame = 3
Query:  123 VWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSL----LVLSAIPIF-----RSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVA 596
            +WRL+TNF +     ++F   +  +ARY   LE+  F  RTADF +M++FGA  L    L+   IP       R  FL  SL FM+VYVWS+  P   ++  GL T  A YLPW +L   ++ GS    DLLG+IAGH+YYFL  ++P  TG+  LKTP +++ L A
Sbjct:   53 IWRLVTNFLYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTSIVLIGGMIPYISETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFA 219          
The following BLAST results are available for this feature:
BLAST of CN185880 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
DERL1_ARATH2.231e-8371.16Derlin-1 OS=Arabidopsis thaliana GN=DER1 PE=2 SV=1[more]
DERL1_ORYSJ2.236e-7572.63Derlin-1 OS=Oryza sativa subsp. japonica GN=DER1 P... [more]
DER12_MAIZE1.893e-7472.92Derlin-1.2 OS=Zea mays GN=DER1.2 PE=2 SV=1[more]
DER11_MAIZE1.227e-7371.35Derlin-1.1 OS=Zea mays GN=DER1.1 PE=2 SV=2[more]
DERL3_BOVIN1.373e-3244.30Derlin-3 OS=Bos taurus GN=DERL3 PE=2 SV=1[more]
DERL3_HUMAN1.793e-3243.04Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2[more]
DERL2_DICDI3.058e-3242.24Probable derlin-2 homolog OS=Dictyostelium discoid... [more]
DERL2_ORYSJ2.589e-3142.51Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 P... [more]
DER22_MAIZE2.589e-3142.51Derlin-2.2 OS=Zea mays GN=DER2.2 PE=2 SV=1[more]
DER21_MAIZE2.589e-3142.51Derlin-2.1 OS=Zea mays GN=DER2.1 PE=2 SV=2[more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A04_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185880 ID=CN185880|Name=CN185880|organism=Citrus sinensis|type=EST|length=712bp
GATTTTTTGCTGCTGCTTATTGTCTCTTCGGAGCATACTACCTTTAAGGG
GAAAACGAAGATCTAAAGCTGCGCGTTTCGCTTGAATTAGCCATCTGAGT
CCGCAATGTCTTCACCTGCTGAGTATGGAGGTTGATAACAAATTTCTTTT
TCCTTGGAACTTTTTCAATCAATTTTGGGATTCGCCTTTTGATGATAGCG
AGATATGGAGTTAACCTGGAGAAGGGACCATTTGAAAGGCGTACAGCAGA
TTTTTTATGGATGATGATTTTTGGAGCCTTATCTCTGTTGGTGTTGTCAG
CCATCCCCATATTTCGATCTTATTTCCTAGGGATATCACTTGTTTTTATG
CTTGTCTATGTCTGGAGTAGAGAATTCCCAAATTCTCAGATCAATATATA
TGGCCTCGTGACACTTAAGGCATTTTATCTACCATGGGCTATGCTTGCTT
TGGACGTCATTTTTGGTTCACCCCTTGTACCAGACCTGCTGGGAATCATA
GCAGGACATCTGTATTACTTTTTGACTGTCTTACATCCACTTGCAACTGG
AAAGAACTTGTTGAAGACTCCAAAATGGGTACAAAAACTGGTGGCGAGGT
GGAGAATCGGAGCTCCAGCTATCAATCGTGCCCAGCCTGAAAGGACAACT
GGTGTGGCTTTCAGAGGAAGATCATATCGTTTAAGCGATTGATTATAATA
TGGCAACGTTCT
back to top