CN185878

Overview
NameCN185878
Unique NameCN185878
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length742
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2200 contig Csv1_Contig2200:12..755. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 4.231e-88
Identity = 159/230 (69.13%), Postives = 188/230 (81.74%), Query Frame = 2
Query:   68 FRSPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAY--NALGEKEKRFEIFKDNLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMYLGARF---GAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            F  PTMA+  L +  VSSA+DMSI+SYD+ H   ++  R++ EVM ++EAW VKHGKA   N+L EK++RFEIFKDNLRF+DEHN +N +Y++GL RFADLTN+EYRS YLGA+    G +RTSL      RY  RVG+ LP+S+DWRKKGAVAEVKDQG CGSCWAFSTI AVEGIN+IVTG LI+LSEQELVDCDTSYNEGCNGGLMDYAFEFII NGGIDT++DYPY
Sbjct:    3 FLKPTMAILFLAMVAVSSAVDMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTSL------RYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPY 226          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 282.337 bits (721), Expect = 1.844e-75
Identity = 142/227 (62.56%), Postives = 171/227 (75.33%), Query Frame = 2
Query:   74 SPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNSEN----RTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            S  +A   L L    +A DMSIVSY +         R+++E   ++  W  +HGK+YNA+GE+E+R+  F+DNLR+IDEHN+       ++++GLNRFADLTNEEYR  YLG R   +R   + K SDRYL    EALP+SVDWR KGAVAE+KDQG CGSCWAFS IAAVEGIN+IVTG LISLSEQELVDCDTSYNEGCNGGLMDYAF+FII+NGGIDTE+DYPY
Sbjct:    4 SMALAAAALLLLLSLAAADMSIVSYGE---------RSEEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRR---ERKVSDRYLAADNEALPESVDWRTKGAVAEIKDQGGCGSCWAFSAIAAVEGINQIVTGDLISLSEQELVDCDTSYNEGCNGGLMDYAFDFIINNGGIDTEDDYPY 218          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 5.745e-69
Identity = 129/228 (56.58%), Postives = 168/228 (73.68%), Query Frame = 2
Query:   83 MAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYN----ALGEKEKRFEIFKDNLRFIDEHNSENR--TYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKR-SDRYLPRV-GEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            +++ LL++    ++ D SI++ D         WRTD+EV  ++  W  +HGK  N     + +++KRF IFKDNLRFID HN +N+  TYK+GL +F DLTN+EYR +YLGAR    R   K+K  + +Y   V G+ +P++VDWR+KGAV  +KDQG+CGSCWAFST AAVEGINKIVTG LISLSEQELVDCD SYN+GCNGGLMDYAF+FI+ NGG++TE+DYPY
Sbjct:    8 LSLLLLYVVVSLASGDESIIN-DHLQLPSDGKWRTDEEVRSIYLQWSAEHGKTNNNNNGIINDQDKRFNIFKDNLRFIDLHNEDNKNATYKLGLTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETVDWRQKGAVNPIKDQGTCGSCWAFSTTAAVEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPY 234          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: ACTN_ACTDE (Actinidain OS=Actinidia deliciosa PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.724e-68
Identity = 135/230 (58.70%), Postives = 172/230 (74.78%), Query Frame = 2
Query:   59 MGLFRSPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNSE-NRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYN-EGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            MGL +S  ++M LLF  T+   L +S+        +K+ + RT+DEV  M+E+W +K+GK+YN+LGE E+RFEIFK+ LRFIDEHN++ NR+YKVGLN+FADLT+EE+RS YLG   G+ +T    K S+RY PRVG+ LP  VDWR  GAV ++K QG CG CWAFS IA VEGINKIVTG LISLSEQEL+DC  + N  GCNGG +   F+FII+NGGI+TEE+YPY
Sbjct:    1 MGLPKS-FVSMSLLFFSTL---LILSLA-----FNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKT----KVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPY 217          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: ACTN_ACTCH (Actinidain OS=Actinidia chinensis PE=1 SV=4)

HSP 1 Score: 254.988 bits (650), Expect = 3.152e-67
Identity = 134/230 (58.26%), Postives = 171/230 (74.35%), Query Frame = 2
Query:   59 MGLFRSPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNSE-NRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYN-EGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            MGL +S  ++M LLF  T+   L +S+        +K+ + RT+DEV  M+E+W +K+GK+YN+LGE E+RFEIFK+ LRFIDEHN++ NR+YKVGLN+FADLT+EE+RS YL    G+ +T    K S+RY PRVG+ LP  VDWR  GAV ++K QG CG CWAFS IA VEGINKIVTG LISLSEQEL+DC  + N  GCNGG +   F+FII+NGGI+TEE+YPY
Sbjct:    1 MGLPKS-FVSMSLLFFSTL---LILSLA-----FNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLRFTSGSNKT----KVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPY 217          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: CPR1_ARATH (Probable cysteine proteinase At3g19400 OS=Arabidopsis thaliana GN=At3g19400 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.730e-65
Identity = 123/221 (55.66%), Postives = 165/221 (74.66%), Query Frame = 2
Query:   86 AMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNS-ENRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSY-NEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            A+ +L +  +SS+L ++         +++   R + EV  M+E W V++ K YN LGEKE+RF+IFKDNL+F+DEHNS  +RT++VGL RFADLTNEE+R++YL  +    + S+K+   +RYL + G+ LPD VDWR  GAV  VKDQG+CGSCWAFS + AVEGIN+I TG LISLSEQELVDCD  + N GC+GG+M+YAFEFI+ NGGI+T++DYPY
Sbjct:   12 ALVILSVLLLSSSLGVA---------TETEIERNETEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRFADLTNEEFRAIYLRKKMERTKDSVKT---ERYLYKEGDVLPDEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDRGFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPY 220          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: XCP2_ARATH (Xylem cysteine proteinase 2 OS=Arabidopsis thaliana GN=XCP2 PE=1 SV=2)

HSP 1 Score: 241.121 bits (614), Expect = 4.711e-63
Identity = 119/209 (56.94%), Postives = 152/209 (72.73%), Query Frame = 2
Query:  116 SSALDMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            +S+ D SIV Y            + D+++ +FE W     KAY  + EK  RFE+FKDNL+ IDE N + ++Y +GLN FADL++EE++ MYLG +    R   +   ++ +  R  EA+P SVDWRKKGAVAEVK+QGSCGSCWAFST+AAVEGINKIVTG+L +LSEQEL+DCDT+YN GCNGGLMDYAFE+I+ NGG+  EEDYPY
Sbjct:   26 ASSHDYSIVGYSP------EDLESHDKLIELFENWISNFEKAYETVEEKFLRFEVFKDNLKHIDETNKKGKSYWLGLNEFADLSHEEFKKMYLGLKTDIVRRDEERSYAE-FAYRDVEAVPKSVDWRKKGAVAEVKNQGSCGSCWAFSTVAAVEGINKIVTGNLTTLSEQELIDCDTTYNNGCNGGLMDYAFEYIVKNGGLRKEEDYPY 227          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.049e-62
Identity = 121/232 (52.16%), Postives = 160/232 (68.97%), Query Frame = 2
Query:   68 FRSPTMAMFLLFLFTVSSAL-------DMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            F +P+++ F L +   +SAL       D SIV Y   H + +      D+++ +FE+W  +H KAY ++ EK  RFE+F++NL  ID+ N+E  +Y +GLN FADLT+EE++  YLG      + S K + S  +  R    LP SVDWRKKGAVA VKDQG CGSCWAFST+AAVEGIN+I TG+L SLSEQEL+DCDT++N GCNGGLMDYAF++II  GG+  E+DYPY
Sbjct:    3 FSAPSLSKFSLLVAISASALLCCAFARDFSIVGYTPEHLTNT------DKLLELFESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRNNEINSYWLGLNEFADLTHEEFKGRYLG--LAKPQFSRKRQPSANFRYRDITDLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAVEGINQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPY 226          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: CYSP4_BRANA (Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.822e-61
Identity = 115/189 (60.85%), Postives = 147/189 (77.78%), Query Frame = 2
Query:  200 MGMFEAWFVKHGKAYN----ALGEKEKRFEIFKDNLRFIDEHNSENR--TYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSD-RYLPRVG-EALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            M ++  W ++HGK+ +     + ++++RF IFKDNLRFID HN  N+  TYK+GL  FA+LTN+EYRS+YLGAR    R   K+K  + +Y   V  + +P +VDWR+KGAV  +KDQG+CGSCWAFST AAVEGINKIVTG L+SLSEQELVDCD SYN+GCNGGLMDYAF+FI+ NGG++TE+DYPY
Sbjct:    1 MSIYLRWSLEHGKSNSNSNGIINQQDERFNIFKDNLRFIDLHNENNKNATYKLGLTIFANLTNDEYRSLYLGARTEPVRRITKAKNVNMKYSAAVNVDEVPVTVDWRQKGAVNAIKDQGTCGSCWAFSTAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPY 189          
BLAST of CN185878 vs. ExPASy Swiss-Prot
Match: CPR4_ARATH (Probable cysteine proteinase At4g11320 OS=Arabidopsis thaliana GN=At4g11320 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 8.315e-60
Identity = 120/234 (51.28%), Postives = 158/234 (67.52%), Query Frame = 2
Query:   59 MGLFRSPTMAMFLLFLFTVS--SALDMSIVSYDKTHESKSSSWRT----DDEVMGMFEAWFVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 742
            MG  +S  M +FLL L   S  +A+DMS+VS +  H   +   R     D E   MFE+W VKHGK Y+++ EKE+R  IF+DNLRFI   N+EN +Y++GLNRFADL+  EY  +  GA     R  +    S+RY    G+ LP SVDWR +GAV EVKDQG C SCWAFST+ AVEG+NKIVTG L++LSEQ+L++C+   N GC GG ++ A+EFI++NGG+ T+ DYPY
Sbjct:    1 MGYAKS-AMLIFLLALVIASCATAMDMSVVSSNDNHHVTAGPGRRQGIFDAEATLMFESWMVKHGKVYDSVAEKERRLTIFEDNLRFITNRNAENLSYRLGLNRFADLSLHEYGEICHGADPRPPRNHVFMTSSNRYKTSDGDVLPKSVDWRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLNKIVTGELVTLSEQDLINCNKE-NNGCGGGKVETAYEFIMNNGGLGTDNDYPY 232          
The following BLAST results are available for this feature:
BLAST of CN185878 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 157
Match NameE-valueIdentityDescription
RD21A_ARATH4.231e-8869.13Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
ORYA_ORYSJ1.844e-7562.56Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
GCP1_ARATH5.745e-6956.58Germination-specific cysteine protease 1 OS=Arabid... [more]
ACTN_ACTDE3.724e-6858.70Actinidain OS=Actinidia deliciosa PE=1 SV=1[more]
ACTN_ACTCH3.152e-6758.26Actinidain OS=Actinidia chinensis PE=1 SV=4[more]
CPR1_ARATH1.730e-6555.66Probable cysteine proteinase At3g19400 OS=Arabidop... [more]
XCP2_ARATH4.711e-6356.94Xylem cysteine proteinase 2 OS=Arabidopsis thalian... [more]
XCP1_ARATH1.049e-6252.16Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
CYSP4_BRANA9.822e-6160.85Cysteine proteinase COT44 (Fragment) OS=Brassica n... [more]
CPR4_ARATH8.315e-6051.28Probable cysteine proteinase At4g11320 OS=Arabidop... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A03_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185878 ID=CN185878|Name=CN185878|organism=Citrus sinensis|type=EST|length=742bp
GCGTTATCAATCCATCTTCTTCTCCCAAAAAGAAAAAAAAAAGCTCTTTT
CTCCAAAGATGGGTTTGTTCAGATCACCAACCATGGCCATGTTTTTACTT
TTTCTCTTCACTGTATCATCTGCCTTGGACATGTCGATTGTATCTTATGA
TAAAACCCATGAGTCAAAATCTAGCAGCTGGAGGACCGACGATGAGGTTA
TGGGTATGTTCGAGGCCTGGTTTGTGAAGCATGGCAAGGCTTATAACGCT
TTGGGTGAAAAAGAGAAAAGGTTTGAGATCTTTAAGGACAATCTTAGGTT
TATTGATGAACATAACTCAGAGAACCGGACCTACAAGGTTGGGTTGAACC
GGTTTGCTGATTTGACCAACGAGGAGTACCGGTCCATGTATCTGGGTGCA
CGCTTTGGTGCTAAAAGGACTTCCTTGAAATCAAAGAGGAGCGATCGTTA
TCTGCCACGTGTCGGCGAGGCGTTGCCGGACTCTGTTGATTGGAGGAAGA
AAGGAGCTGTCGCTGAAGTTAAAGATCAAGGAAGCTGTGGGAGTTGCTGG
GCATTTTCAACCATTGCTGCTGTAGAGGGTATAAACAAGATTGTTACAGG
TAGCCTGATCTCACTATCCGAGCAGGAGTTGGTGGATTGTGATACATCAT
ATAATGAAGGATGTAATGGTGGTTTGATGGACTATGCATTCGAGTTCATT
ATTGATAATGGAGGTATTGACACAGAAGAAGATTACCCCTAC
back to top