DC900072

Overview
NameDC900072
Unique NameDC900072
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length598
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6051 contig Csv1_Contig6051:887..1488. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900072 vs. ExPASy Swiss-Prot
Match: EI2BB_DICDI (Translation initiation factor eIF-2B subunit beta OS=Dictyostelium discoideum GN=eif2b2 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.122e-11
Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 3
Query:   51 LHVVNPAFDYVPPKLVSLFITDAGGHNPSYMYRLIADYYSADDLV 185
            +H  NP FDYV P LVSLFIT+ GGHNPSY+YRL+ +YY A D++
Sbjct:  341 VHSYNPTFDYVAPDLVSLFITNIGGHNPSYIYRLLQEYYDARDIL 385          
The following BLAST results are available for this feature:
BLAST of DC900072 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
EI2BB_DICDI2.122e-1164.44Translation initiation factor eIF-2B subunit beta ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900072 VSS Citrus sinensis cDNA clone VS27Q78 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900072 ID=DC900072|Name=DC900072|organism=Citrus sinensis|type=EST|length=598bp
GAGAATTCTCAGACTGCATGGATTTTGGGAGTGGCAGTGGTTCCCCTCTT
CTTCATGTGGTCAATCCAGCATTTGACTATGTTCCACCGAAACTTGTTAG
TCTTTTTATTACTGACGCGGGAGGGCACAATCCTTCATACATGTATCGGT
TGATTGCTGATTATTACTCGGCTGATGACTTGGTTGTGCAGCGAAGAGCT
ACTGCTGGGAATTGATTTTGGTTTGTATCATCTATTGTGAATTTATTACG
GCAAGAGCATTAGCTTTGGGTTTGAGAAATTTCAAATCACTGAATTTGGA
GCTGAGCTGATGCTGTAAAAGAACTCAGGGACATAGCGATTGCGAGGCAA
TGGTGTGAACTTAGTGCAAATTTTAGGGACGCAAACAATGATAGGATAAT
TTTTGTTGGCAGAAATATTAAAATGTAAAATAGAGGCTAAGAGTTGTACT
GAGATAAAAAGGTGGATACGGTTAGATAATATTTTTTGATTGTATCAAGG
TTGGTGGTCAAGTGCTGTATTCTTCTTCATCAGTGATTTTCAGACGGACG
GTATAACATTGTTGTATTGCTTGTTGCTTAAAATTTTCATAGCAGAAC
back to top