DC900069

Overview
NameDC900069
Unique NameDC900069
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length526
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3696 contig Csv1_Contig3696:946..1471. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900069 vs. ExPASy Swiss-Prot
Match: PIP_ARATH (Proline iminopeptidase OS=Arabidopsis thaliana GN=PIP PE=2 SV=3)

HSP 1 Score: 103.605 bits (257), Expect = 5.857e-22
Identity = 45/55 (81.82%), Postives = 50/55 (90.91%), Query Frame = 3
Query:    3 QGRYDVCCPMMSAWDLHKAWPEADFKVVADAGHSANEPGIAAELVATNEKLKNLI 167
            QGRYDVCCPMMSAWDLHKAWPEA+ K+V DAGHSANEPGI+AELV  NEK+K L+
Sbjct:  325 QGRYDVCCPMMSAWDLHKAWPEAELKIVYDAGHSANEPGISAELVVANEKMKALM 379          
The following BLAST results are available for this feature:
BLAST of DC900069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PIP_ARATH5.857e-2281.82Proline iminopeptidase OS=Arabidopsis thaliana GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900069 VSS Citrus sinensis cDNA clone VS27Q74 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900069 ID=DC900069|Name=DC900069|organism=Citrus sinensis|type=EST|length=526bp
TACAGGGAAGGTATGATGTTTGTTGCCCTATGATGTCGGCTTGGGATCTT
CACAAGGCATGGCCAGAAGCAGATTTTAAGGTAGTAGCAGATGCTGGACA
TTCAGCGAATGAACCAGGAATAGCTGCAGAACTCGTGGCTACAAATGAGA
AGCTGAAAAACCTTATCAAGAATGGACATTGAAAAAGACCGGATGCAGCA
TGTCCTTAAGATCAATGACTACAATCAAAGATACACTGCACATTCTCGAT
GATGTGCCTTGACATATCTACAAGAAACTATGGGTCATTTTAAGCTAGTT
GAATGGAATGCAATTCTTGTAAAACTGTTGAATGTGTATTTTACGTGTAC
AATTCTCCACGGCGGTTTCATGATTGAGACACTGCCTGGGCAATAAGTAA
AATCCCTTAATCATACAAGCTTACAAGACAGATTTGAAGAGTAAGTTGCC
GTGGATTGGTAATATAGAAAACCTTGTCGAAGTGTAAAAAATTTGAAGTT
TTTATAAATTTGTTAATACGTCTGTC
back to top