CN185869

Overview
NameCN185869
Unique NameCN185869
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length781
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1162 contig Csv1_Contig1162:70..850. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL4_ARATH (IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsis thaliana GN=ILL4 PE=1 SV=2)

HSP 1 Score: 245.743 bits (626), Expect = 2.076e-64
Identity = 119/186 (63.98%), Postives = 149/186 (80.11%), Query Frame = -1
Query:  224 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLEFGPEISLPEGNYRDEL 781
            EADPLDSQVVTVAKF+GGGAFNVIPDSV IGGTFRAFS +SF QLK+RIE+VI  QA+V  C+ATVDF+ +EKPFFPPT+N+  LH++F+ V+GDML  +    M P+MGSEDFSFYQ+ +PG+F F+GM+N+    + S HSPYF +NE+ LPYGA+LHAS+A RYLLE     +L + N +DEL
Sbjct:  256 EADPLDSQVVTVAKFEGGGAFNVIPDSVTIGGTFRAFSTKSFMQLKKRIEQVITRQASVNMCNATVDFIEEEKPFFPPTVNDKALHQFFKNVSGDMLGIENYVEMQPLMGSEDFSFYQQAIPGHFSFVGMQNKARSPMASPHSPYFEVNEELLPYGASLHASMATRYLLELKAS-TLNKSNKKDEL 440          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSJ (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. japonica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.542e-64
Identity = 121/174 (69.54%), Postives = 140/174 (80.46%), Query Frame = -1
Query:  263 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPG-YFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLEFGP 781
            EADPLDSQVVTV KFQGGGAFNVIPDSV IGGTFRAF KESF QLKQRIEEVI+ QA+VQRC+A VDFL K++PFFPPTIN+  LH +F  VA +M+  + V+   P+MG+EDF+FY + +P  Y++FLGM NET G     HSPYFT+NEDALPYGAAL ASLA RYLLE  P
Sbjct:  257 EADPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRCNAVVDFLDKDRPFFPPTINSAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIPATYYYFLGMYNETRGPQAPHHSPYFTINEDALPYGAALQASLAARYLLEHQP 430          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSI (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. indica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.542e-64
Identity = 121/174 (69.54%), Postives = 140/174 (80.46%), Query Frame = -1
Query:  263 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPG-YFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLEFGP 781
            EADPLDSQVVTV KFQGGGAFNVIPDSV IGGTFRAF KESF QLKQRIEEVI+ QA+VQRC+A VDFL K++PFFPPTIN+  LH +F  VA +M+  + V+   P+MG+EDF+FY + +P  Y++FLGM NET G     HSPYFT+NEDALPYGAAL ASLA RYLLE  P
Sbjct:  257 EADPLDSQVVTVGKFQGGGAFNVIPDSVTIGGTFRAFLKESFNQLKQRIEEVIVSQASVQRCNAVVDFLDKDRPFFPPTINSAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIPATYYYFLGMYNETRGPQAPHHSPYFTINEDALPYGAALQASLATRYLLEHQP 430          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL5_ARATH (IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsis thaliana GN=ILL5 PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.823e-52
Identity = 102/170 (60.00%), Postives = 128/170 (75.29%), Query Frame = -1
Query:  272 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLE 781
            EADPLDSQVVTVA F+G  AFNVIPDSV IGGTFRA   +SF QLKQRI +VI  QA+V  C+ATVDFL  E P FPPT+NN  LH +++ V+ DML  +      PVM SEDF+FYQ+ +PG+F F+GM+N++   + + HSP+F +NE+ LPYGA+L ASLA RYLL+
Sbjct:  256 EADPLDSQVVTVATFEGSDAFNVIPDSVTIGGTFRALLPKSFEQLKQRIVQVITTQASVNMCNATVDFLEDETPPFPPTVNNKTLHLFYKNVSVDMLGIENYVETLPVMVSEDFAFYQQAIPGHFSFVGMQNKSHSPMANPHSPFFEVNEELLPYGASLLASLATRYLLD 425          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL2_ARATH (IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsis thaliana GN=ILL2 PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 1.223e-48
Identity = 97/170 (57.06%), Postives = 126/170 (74.12%), Query Frame = -1
Query:  272 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLE 781
            E DPLDS+VVTV+K  GG AFNVIPDS+ IGGT RAF+   FTQL+QR++EVI  QAAV RC+A+V+     +   PPT+NN DL+K F+ V  D+L  +     APVMGSEDFS++ E +PG+F  LGM++ET G   S+HSP + +NED LPYGAA+HAS+A++YL E
Sbjct:  259 ETDPLDSKVVTVSKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNG-YASSHSPLYRINEDVLPYGAAIHASMAVQYLKE 425          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL2_ORYSJ (IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sativa subsp. japonica GN=ILL2 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 6.069e-48
Identity = 96/173 (55.49%), Postives = 125/173 (72.25%), Query Frame = -1
Query:  272 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQK--VKVMAPVMGSEDFSFYQEVMP-GYFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLE 781
            EADPL++QVVTV +F  G A NVIP+S+ IGGTFR FS E F +LK+RIEEVI+ Q+AV RC+A VDF +  +P  PPTIN+  LH +FQ VA + L      +  M P MGSEDF+ + E +P  +F+F+G++NE  G V   HSP+F +++ ALPYGAALHASLA+RYL E
Sbjct:  271 EADPLEAQVVTVTRFLAGDALNVIPESITIGGTFRVFSNEGFLRLKRRIEEVIVAQSAVYRCAAAVDFHAGGRPLLPPTINSAALHAHFQAVAAETLGASAAVLGAMEPCMGSEDFAVFSEAVPASHFYFVGVRNEAEGLVHLAHSPHFRVDDAALPYGAALHASLAMRYLDE 443          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL1_ARATH (IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsis thaliana GN=ILL1 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 7.419e-46
Identity = 95/186 (51.08%), Postives = 129/186 (69.35%), Query Frame = -1
Query:  224 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLEFGPEISLPEGNYRDEL 781
            E DP DS+VVTV K  GG AFNVIPDS+ IGGT RAF+   FTQL++RI+E+I  QAAV RC+A+V+         PPT+NN DL+K F+ V  D+L  +      P MGSEDFS++ E +PG+F  LGM++ET G   S+HSP++ +NED LPYGAA+HA++A++YL +   + S+    + DEL
Sbjct:  258 ETDPSDSKVVTVTKVNGGNAFNVIPDSITIGGTLRAFT--GFTQLQERIKEIITKQAAVHRCNASVNLAPNGNQPMPPTVNNMDLYKKFKKVVRDLLGQEAFVEAVPEMGSEDFSYFAETIPGHFSLLGMQDETQG-YASSHSPHYRINEDVLPYGAAIHATMAVQYLKDKASKGSV--SGFHDEL 438          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL6_ARATH (IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsis thaliana GN=ILL6 PE=2 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 2.387e-44
Identity = 83/168 (49.40%), Postives = 118/168 (70.24%), Query Frame = -1
Query:  278 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYL 781
            EA PLDSQVV+V  F GG + +V PD+V++GGTFRAFS  SF  LK+RI+EV++ Q  V  C ATV+F  K+   +PPT NN+  + + + V  D+L      +   +MG+EDF+FY E++P  F+F+G++NE LG V   HSP+F ++ED+LP GAA+HA++A RYL
Sbjct:  292 EASPLDSQVVSVTSFDGGHSLDVAPDTVVLGGTFRAFSNSSFYYLKKRIQEVLMDQVGVFGCQATVNFFEKQNAIYPPTTNNDATYNHLKKVTIDLLGDSHFTLAPQMMGAEDFAFYSEIIPAAFYFIGIRNEELGSVHIAHSPHFMIDEDSLPVGAAVHAAVAERYL 459          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL6_ORYSJ (IAA-amino acid hydrolase ILR1-like 6 OS=Oryza sativa subsp. japonica GN=ILL6 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.810e-42
Identity = 87/184 (47.28%), Postives = 120/184 (65.22%), Query Frame = -1
Query:  254 EADPLDSQVVTVAKFQGG--------GAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESTHSPYFTLNEDALPYGAALHASLALRYLLEFGPEIS 781
            EADPLDSQVV+VA   G          A     +  ++GGTFRAFS  SF Q+++RIEEVI  QA V  C A VDF   +  F+PPT+N+  ++ + + VAG++L     + + P+MG+EDFSFY +V+P  F+++G++NETLG V + HSPYF ++ED LP GAA HA++A RYL    P  S
Sbjct:  313 EADPLDSQVVSVAMVNGSDHPAATARAAAAEEEEEFVLGGTFRAFSNASFYQVRRRIEEVITAQARVHGCEAAVDFFENQS-FYPPTVNDARMYAHVKAVAGELLGAGSYRDVPPMMGAEDFSFYSQVVPAGFYYIGVRNETLGSVHTGHSPYFMIDEDVLPTGAAFHAAIAERYLANHSPSSS 495          
BLAST of CN185869 vs. ExPASy Swiss-Prot
Match: ILL7_ORYSJ (IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sativa subsp. japonica GN=ILL7 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.448e-41
Identity = 81/169 (47.93%), Postives = 119/169 (70.41%), Query Frame = -1
Query:  278 EADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNE-TLGKVESTHSPYFTLNEDALPYGAALHASLALRYL 781
            E DPL++ V++V   +GG A+NVIP+SV  GGTFR+ + E  + LK+RI+E++   A V RC+ATVDF+ +E+  +P T+N+  ++++ + VA D+L    VKV  P MGSEDF+FY +  P  FF +G+ NE T+ KV   HSP+F ++ED LP GAALHA++A+ YL
Sbjct:  278 ETDPLEAAVISVTFMKGGDAYNVIPESVSFGGTFRSLTSEGLSYLKKRIKEIVEAHATVHRCTATVDFMEEERIPYPATVNDEGMYRHARAVAVDVLGEDGVKVGTPFMGSEDFAFYAQRFPAAFFMIGVGNETTMRKVYPLHSPHFVVDEDVLPVGAALHAAVAMEYL 446          
The following BLAST results are available for this feature:
BLAST of CN185869 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 51
Match NameE-valueIdentityDescription
ILL4_ARATH2.076e-6463.98IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsi... [more]
ILL1_ORYSJ3.542e-6469.54IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL1_ORYSI3.542e-6469.54IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL5_ARATH1.823e-5260.00IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsi... [more]
ILL2_ARATH1.223e-4857.06IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsi... [more]
ILL2_ORYSJ6.069e-4855.49IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sati... [more]
ILL1_ARATH7.419e-4651.08IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsi... [more]
ILL6_ARATH2.387e-4449.40IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsi... [more]
ILL6_ORYSJ3.810e-4247.28IAA-amino acid hydrolase ILR1-like 6 OS=Oryza sati... [more]
ILL7_ORYSJ1.448e-4147.93IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P23_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185869 ID=CN185869|Name=CN185869|organism=Citrus sinensis|type=EST|length=781bp
TTTTTTTTTTTTTTTTTCCGATAGAAATGTTATTCGCAATGCCTCAATTA
TTTCCAAAATTATTTTGTCTTGATACATTGACGAATGTTAACTTATTTCC
CACCTAACTGAAAATCAATAAGATGTTCTTCCTTGAATCAAACTTGTATA
ACAGGACATTCTGGTAACATTTACACCAGTACTGGATTCCATAGTCATTG
ATAAGCAAGTCAACAGTACCTTACAGTTCATCGCGGTAGTTTCCCTCTGG
CAAAGAAATTTCTGGTCCAAACTCAAGAAGATACCTTAAAGCAAGTGATG
CATGAAGTGCGGCTCCATAAGGAAGTGCATCTTCATTGAGTGTGAAGTAG
GGGGAGTGTGTAGATTCAACCTTCCCAAGTGTCTCATTCTTCATCCCTAG
GAAGAAGAAGTATCCAGGCATTACTTCTTGGTAAAATGAGAAATCTTCAG
ATCCCATCACTGGTGCCATAACCTTAACTTTTTGAGTATCAAGCATATCT
CCAGCAACAGTTTGGAAGTACTTGTGCAAATCGTTATTGTTTATGGTGGG
AGGGAAAAAGGGTTTCTCTTTTGACAGGAAATCAACAGTTGCACTGCATC
TCTGTACTGCAGCTTGCCCAATGATAACCTCCTCAATACGTTGCTTTAGT
TGCGTGAAGCTTTCCTTTGAAAAGGCCCGGAAAGTGCCTCCAATTAATAC
TGAATCTGGAATGACATTGAATGCACCACCTCCTTGAAATTTTGCAACTG
TCACGACCTGTGAATCAAGTGGATCAGCTTC
back to top