DC900067

Overview
NameDC900067
Unique NameDC900067
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length761
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12156 contig Csv1_Contig12156:790..1550. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900067 vs. ExPASy Swiss-Prot
Match: RA212_ARATH (Ethylene-responsive transcription factor RAP2-12 OS=Arabidopsis thaliana GN=RAP2-12 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.720e-19
Identity = 68/170 (40.00%), Postives = 85/170 (50.00%), Query Frame = 3
Query:    6 LEEKPQVNQYGYLGSFPNDGELGFKPFVPTADDTPLYFNSDQGSNSFDCSDFGWGEQAPKTPEISSVLEATPEVDESQFVDAVANPMKKLKSNSENAVPVQDNNGKSLSDELLAFDNQVKFLPMPYPEGSWEASLDAFLNGD--NTQDGG-NLMNLWSFDDFPSTLGGVY 506
            +EEK QV+         N+ + G    V    +   YF+SDQGSNSFDCS+FGW +QAP TP+ISS   A    + S      ANP KKLKS                    + F+        PY    W+ASLD FLN D   TQD G N M+LWS D+  S +GGV+
Sbjct:  227 MEEKHQVSNN-------NNNQFGMTNSVDAGCNGYQYFSSDQGSNSFDCSEFGWSDQAPITPDISS---AVINNNNSALFFEEANPAKKLKS--------------------MDFET-------PYNNTEWDASLD-FLNEDAVTTQDNGANPMDLWSIDEIHSMIGGVF 358          
BLAST of DC900067 vs. ExPASy Swiss-Prot
Match: RAP22_ARATH (Ethylene-responsive transcription factor RAP2-2 OS=Arabidopsis thaliana GN=RAP2-2 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.165e-18
Identity = 68/168 (40.48%), Postives = 89/168 (52.98%), Query Frame = 3
Query:    6 LEEKPQV--NQYGYLGSFPNDGELGFKPFVPTADDTPLYFNSDQGSNSFDCSDFGWGEQAPKTPEISSVLEATPEVDESQFVDAVANPMKKLKSNSENAVPVQDNNGKSLSDELLAF-DNQVKFLPMPYPEGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFPSTLGG 500
            +EEKPQ+  NQ+G   SF   G  G++           YF+SDQGSNSFDCS+FGW +  PKTPEISS+L      +E+ FV+   N  KKLK NS+             SD+L+A+ DN +   P+       EA L A   G  TQ+  N + LWS D+    L G
Sbjct:  243 MEEKPQMYNNQFGLTNSFDAGGNNGYQ-----------YFSSDQGSNSFDCSEFGWSDHGPKTPEISSMLVNN---NEASFVEE-TNAAKKLKPNSDE------------SDDLMAYLDNALWDTPLEV-----EAMLGADA-GAVTQEEENPVELWSLDEINFMLEG 377          
BLAST of DC900067 vs. ExPASy Swiss-Prot
Match: ERF1_ORYSJ (Ethylene-responsive transcription factor 1 OS=Oryza sativa subsp. japonica GN=EREBP1 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.027e-16
Identity = 58/141 (41.13%), Postives = 79/141 (56.03%), Query Frame = 3
Query:   81 PFVPTADDT-PL---YFNSDQGSNSFDCSDFGWGEQAPKTPEISSV--LEATPEVDESQFVDAVANPMKKLKSNSENAVPVQDNNGKSLSDELLAFDNQVKFLPMPYPEGSWEASLDAFLNGDNTQDGGNLMNLWSFDDFP 485
            PFVP  +   P+     NSDQGSNSF CSDFGW E   KTP+I+S+  +    EVDES F+ +  NPM           PV +N+   L D     +  ++FL     +G+ + S+D+ LN D +QD  + M+LWSFDD P
Sbjct:  238 PFVPAMNSAAPIEDPIINSDQGSNSFGCSDFGW-ENDTKTPDITSIAPISTIAEVDESAFIKSSTNPM---------VPPVMENSAVDLPD----LEPYMRFL---LDDGAGD-SIDSLLNLDGSQDVVSNMDLWSFDDMP 360          
The following BLAST results are available for this feature:
BLAST of DC900067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
RA212_ARATH9.720e-1940.00Ethylene-responsive transcription factor RAP2-12 O... [more]
RAP22_ARATH2.165e-1840.48Ethylene-responsive transcription factor RAP2-2 OS... [more]
ERF1_ORYSJ2.027e-1641.13Ethylene-responsive transcription factor 1 OS=Oryz... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900067 VSS Citrus sinensis cDNA clone VS27Q72 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900067 ID=DC900067|Name=DC900067|organism=Citrus sinensis|type=EST|length=761bp
GTATTCTGGAGGAGAAACCACAAGTGAATCAGTATGGATATTTGGGCTCC
TTCCCTAATGATGGAGAACTAGGATTCAAACCCTTTGTGCCAACAGCTGA
TGATACTCCTTTGTACTTCAACTCTGACCAAGGCAGTAACTCCTTTGATT
GTTCTGACTTTGGCTGGGGAGAACAGGCACCAAAGACTCCTGAAATCTCA
TCTGTTTTGGAAGCTACCCCTGAAGTTGATGAATCTCAGTTTGTGGATGC
GGTTGCAAACCCGATGAAGAAGCTGAAATCTAACTCTGAGAATGCTGTGC
CTGTTCAGGATAACAATGGAAAGTCTCTGTCTGATGAGCTTTTGGCTTTT
GACAATCAGGTGAAGTTCTTGCCAATGCCGTATCCTGAAGGAAGCTGGGA
GGCCTCCCTCGATGCCTTCCTCAATGGTGACAACACTCAGGATGGTGGAA
ACTTGATGAACCTTTGGAGCTTTGATGACTTCCCTTCTACCCTAGGGGGA
GTGTATTGAGCAAACTTTAATGTGCTTGCTAGTTTTGTAAATAAGGCTAT
ATCTTTGAGGACTGGTTGTCTATCTGTGTTGGAGATGCAGTGCTTAATTG
TTGGACATGCTTAAGCCAAGCCATGTGTGGAGATTGCTCTCAGGAGCTTT
CAGTAGATTCTTAGTATATAGGGGGGTTAGGGTCCTTTTANCTATGAGAC
TGGAGCATTTGACATTTGCATCTAGGNTGGATGGATGATATGGGGGATTG
GACAAACGACC
back to top