DC900064

Overview
NameDC900064
Unique NameDC900064
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length970
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900064_ssr40 microsatellite DC900064_ssr40:40..51. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1814 contig Csv1_Contig1814:32..1000. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: UMPK_ARATH (Uridylate kinase OS=Arabidopsis thaliana GN=PYR6 PE=1 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.911e-64
Identity = 120/138 (86.96%), Postives = 130/138 (94.20%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQGREDDNVETIREAV*GFL 605
            LGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKA++E+GNDKFLIDGFPRNEENRAAFE VT+IEP+FVLFFDC EEEME+R+L RNQGREDDN+ETIR+    FL
Sbjct:   20 LGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAIQENGNDKFLIDGFPRNEENRAAFEKVTEIEPKFVLFFDCPEEEMEKRLLGRNQGREDDNIETIRKRFKVFL 157          

HSP 2 Score: 82.0333 bits (201), Expect = 5.593e-15
Identity = 41/66 (62.12%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  544 GIREEKMITLRQLGKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFDAVKAVFTPKDEKAAA 741
            G  ++ + T+R   KRFKVFLESSLPV+ YYEAKGKVRKI+AAKP+  VF+ VKA+F+P+ EK  A
Sbjct:  140 GREDDNIETIR---KRFKVFLESSLPVIHYYEAKGKVRKINAAKPIEAVFEEVKAIFSPEAEKVEA 202          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KAD_PRUAR (Adenylate kinase OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 3.078e-55
Identity = 91/132 (68.94%), Postives = 110/132 (83.33%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQGREDDNVETIRE 587
            LGGPGSGKGTQCA IVE FG+TH+SAGDLLR EI SGS  G++I + I+EGKIVPS+VT++L+QK ME S N KFLIDGFPR+EENR AFE     EP+ VLFFDC E+EM +R+LNRNQGR DDN++TI++
Sbjct:   53 LGGPGSGKGTQCAKIVEAFGFTHVSAGDLLRREIASGSAYGSVILSTIREGKIVPSQVTVELIQKEMESSDNYKFLIDGFPRSEENRKAFEQTIGAEPDVVLFFDCPEQEMVKRVLNRNQGRVDDNIDTIKK 184          

HSP 2 Score: 46.2098 bits (108), Expect = 3.078e-55
Identity = 19/45 (42.22%), Postives = 30/45 (66.67%), Query Frame = 1
Query:  586 KRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFDAVKAVFTP 720
            KR ++F E + PV+ YY  +GK+ KI+A   V E+F+ V+ +F P
Sbjct:  184 KRLEIFDELNWPVINYYSQRGKLHKINAVGTVDEIFEKVRPIFAP 228          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KCY_DICDI (Cytidylate kinase OS=Dictyostelium discoideum GN=pyrK PE=1 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 1.985e-41
Identity = 81/136 (59.56%), Postives = 104/136 (76.47%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTK--IEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIRE 587
            LGGPGSGKGTQCANIV  FG+ HLSAGDLLR E +SGS++G MI  MIK G+IVPS VT+KLL+ A++ +    FL+DGFPRNEEN  ++E   K  ++ +FVLFFDC EE M +R+L R +  GR DDN+E+I++
Sbjct:   13 LGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKK 148          

HSP 2 Score: 28.8758 bits (63), Expect = 1.985e-41
Identity = 15/48 (31.25%), Postives = 26/48 (54.17%), Query Frame = 1
Query:  571 LRQLGKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFDAVKAVF 714
            +  + KRF  F   +  V+ +Y    KV+ I A + V EV++ V+ +F
Sbjct:  143 IESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLF 190          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: UMPK_YEAST (Uridylate kinase OS=Saccharomyces cerevisiae GN=URA6 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 3.539e-37
Identity = 70/138 (50.72%), Postives = 99/138 (71.74%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEI-KSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEE---SGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIRE 587
            LGGPG+GKGTQC  +V+ + + HLSAGDLLRAE  ++GS+ G +I+N IKEG+IVP E+T+ LL+ A+ +   +   KFLIDGFPR  +   +FE    +E +F+LFFDC E+ M  R+L R +  GR DDN+E+I++
Sbjct:   22 LGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFER-DIVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKK 158          

HSP 2 Score: 40.0466 bits (92), Expect = 3.539e-37
Identity = 16/45 (35.56%), Postives = 29/45 (64.44%), Query Frame = 1
Query:  571 LRQLGKRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFDAVK 705
            +  + KRF  F E+S+PV++Y+E K KV ++   + V +V+  V+
Sbjct:  153 IESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQ 197          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KCY_CHICK (UMP-CMP kinase OS=Gallus gallus GN=CMPK1 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.193e-33
Identity = 80/149 (53.69%), Postives = 102/149 (68.46%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIK-SGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEE-----SGNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIREAV*GFLR 608
            LGGPG+GKGTQCA IVE +GYTHLSAGDLLR E K  GS+ G +I+N IKEG+IVP E+TI LL++AM++     S  +KFLIDGFPRNE+N   +      K +  FVLFFDC  E    R L R  + GR DDN E++ + +  +L+
Sbjct:    9 LGGPGAGKGTQCARIVEKYGYTHLSAGDLLRDERKRPGSQYGELIENYIKEGEIVPVEITISLLKRAMDQTMAANSQKNKFLIDGFPRNEDNLQGWNKTMDGKADVSFVLFFDCDNEICIGRCLERGKSSGRSDDNRESLEKRIHTYLQ 157          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KCY_XENLA (UMP-CMP kinase OS=Xenopus laevis GN=cmpk1 PE=2 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 1.010e-32
Identity = 77/149 (51.68%), Postives = 100/149 (67.11%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAME-----ESGNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIREAV*GFLR 608
            LGGPG+GKGTQC  IV+ +GYTHLSAGDLLR E K   S+ G +I++ I++GKIVP E+TI LLQ+AME     ++   KFLIDGFPRNE+N   +E     K +  FVLFFDC  E    R L R  + GR DDN E++ + +  +L+
Sbjct:    9 LGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGKIVPVEITISLLQRAMERTMAFDANKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQ 157          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KAD1_CYPCA (Adenylate kinase isoenzyme 1 OS=Cyprinus carpio GN=ak1 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 1.064e-32
Identity = 64/137 (46.72%), Postives = 92/137 (67.15%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAM--EESGNDKFLIDGFPRNEENRAAFEAVTKI-EPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIRE 587
            +GGPGSGKGTQC  IVE +GYTHLS+GDLLRAE+ SGSE G  +Q ++++G++VP +  + +++ AM  +   +  +LIDG+PR  +    FE   KI  P  +L+ D   E M +R++ R Q  GR DDN ETI++
Sbjct:   14 VGGPGSGKGTQCEKIVEKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGYLIDGYPREVKQGEEFE--KKIGAPALLLYIDAKAETMVQRLMKRGQTSGRSDDNEETIKK 148          

HSP 2 Score: 40.0466 bits (92), Expect = 1.064e-32
Identity = 20/43 (46.51%), Postives = 30/43 (69.77%), Query Frame = 1
Query:  586 KRFKVFLESSLPVVQYYEAKGKVRKIDAAKPVAEVFD-AVKAV 711
            KR  ++ +++ PV+ YYE +G VRKI++  PV EVF   VKA+
Sbjct:  148 KRLDLYYKATEPVIAYYETRGIVRKINSELPVDEVFAIVVKAI 190          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KCY_XENTR (UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.722e-32
Identity = 78/149 (52.35%), Postives = 102/149 (68.46%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEES----GN-DKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIREAV*GFLR 608
            LGGPG+GKGTQC  IV+ +GYTHLSAGDLLR E K   S+ G +I++ I++G+IVP E+TI LLQ+AME++    GN  KFLIDGFPRNE+N   +E     K +  FVLFFDC  E    R L R  + GR DDN E++ + +  +L+
Sbjct:    9 LGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQ 157          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KCY_DANRE (UMP-CMP kinase OS=Danio rerio GN=cmpk1 PE=2 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 2.938e-32
Identity = 79/149 (53.02%), Postives = 103/149 (69.13%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAE-IKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEES-----GNDKFLIDGFPRNEENRAAF--EAVTKIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIREAV*GFLR 608
            LGGPG+GKGTQCA IVE++ YTHLSAGDLLR E  ++ SE G +I + IKEGKIVP ++TI LL+KAMEE+        +FLIDGFPRN++N   +  E   K + +FVLFFDCS E    R L R  + GR DDN E++ + +  +L+
Sbjct:    9 LGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQ 157          
BLAST of DC900064 vs. ExPASy Swiss-Prot
Match: KCY_HUMAN (UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3)

HSP 1 Score: 137.117 bits (344), Expect = 1.458e-31
Identity = 76/153 (49.67%), Postives = 102/153 (66.67%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEE-----SGNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIREAV*GFLRI*SP 620
            LGGPG+GKGTQCA IVE +GYTHLSAG+LLR E K+  S+ G +I+  IKEGKIVP E+TI LL++ M++     +  +KFLIDGFPRN++N   +      K +  FVLFFDC+ E    R L R  + GR DDN E++ + +  +L+   P
Sbjct:    9 LGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKP 161          
The following BLAST results are available for this feature:
BLAST of DC900064 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
UMPK_ARATH2.911e-6486.96Uridylate kinase OS=Arabidopsis thaliana GN=PYR6 P... [more]
KAD_PRUAR3.078e-5568.94Adenylate kinase OS=Prunus armeniaca PE=2 SV=1[more]
KCY_DICDI1.985e-4159.56Cytidylate kinase OS=Dictyostelium discoideum GN=p... [more]
UMPK_YEAST3.539e-3750.72Uridylate kinase OS=Saccharomyces cerevisiae GN=UR... [more]
KCY_CHICK1.193e-3353.69UMP-CMP kinase OS=Gallus gallus GN=CMPK1 PE=2 SV=1[more]
KCY_XENLA1.010e-3251.68UMP-CMP kinase OS=Xenopus laevis GN=cmpk1 PE=2 SV=... [more]
KAD1_CYPCA1.064e-3246.72Adenylate kinase isoenzyme 1 OS=Cyprinus carpio GN... [more]
KCY_XENTR1.722e-3252.35UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2... [more]
KCY_DANRE2.938e-3253.02UMP-CMP kinase OS=Danio rerio GN=cmpk1 PE=2 SV=2[more]
KCY_HUMAN1.458e-3149.67UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900064 VSS Citrus sinensis cDNA clone VS27Q69 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900064 ID=DC900064|Name=DC900064|organism=Citrus sinensis|type=EST|length=970bp
TTGGCATCCCTCTGCCTTCTTTCTTTCCCTCCATATTCTTCTCTCTCTCT
CCAAACAAAACAACGCTCGCAATTCGCTAAGATCGGTTATTCAGACTGAG
TTAGTTGGCGCTGATGGGAACTGTGGTTGAAACTCCTGTCAAGGAAGCAG
ATGCTACCGTAACTGTGAAGAAGCCCACTGTTGTTTTTGTTTTGGGTGGA
CCAGGCAGTGGAAAAGGAACCCAGTGCGCAAACATTGTTGAACACTTTGG
ATACACCCATCTCAGTGCTGGTGATCTTCTCAGAGCCGAAATCAAATCTG
GCTCTGAAAATGGAACCATGATTCAGAACATGATTAAAGAGGGAAAAATC
GTTCCTTCAGAGGTCACAATTAAGCTTCTCCAAAAAGCAATGGAGGAAAG
TGGAAATGATAAATTTCTCATCGATGGTTTTCCCAGAAACGAGGAAAATC
GTGCTGCATTTGAAGCTGTTACCAAAATTGAGCCAGAATTCGTTCTGTTT
TTTGACTGTTCTGAGGAGGAGATGGAGAGGCGCATTTTGAATAGGAATCA
GGGAAGAGAAGATGATAACGTTGAGACAATTAGGGAAGCGGTTTAAGGTT
TTCTTAGAATCTAGTCTCCCTGTGGTTCAATATTATGAAGCTAAGGGTAA
AGTTCGGAAGATTGATGCTGCAAAGCCTGTTGCAGAGGTTTTTGATGCTG
TTAAAGCTGTTTTTACCCCAAAAGATGAGAAGGCTGCTGCTTAGGTCTTC
TCTGTCCAGAGTATCAGATTTAATATTAAGGTGGTGGTATTGTTGTTGGC
TGCTGCCTATTANTGTACTTTATTATTATGAGGTTATTATGCCACATGTT
TTACTAGAATGTCATAGAAGTTCATAGTGTATCATGATATTTATTCTTGT
TTGCCTATGTATTCTTGTTATTGAGACTGTAATAGCAAGATCAAGAGTAA
TAATAACAGCATTGATGCTT
back to top